Gene Details:

  • Gene ID: ORUFI04G03370.1
  • Gene Family: CPP Family
  • Description: CPP Family protein
  • Species: Oryza rufipogon
  • Source: CPP family gene from PlantTFDB

Protein Features:

Annotation Proteins:

Family Introduction:

  • CPP-like (cystein-rich polycomb-like protein) proteins are members of a small transcription factor family whose typical feature is the existence of one or two similar Cys-rich domains termed the CXC domain. The members of this family are widely present in plants and animals but absent in yeast, and the CXC domains of CPP-like proteins show high conservation across species from amoebae though plants to mammals (Andersen et al. 2007; Riechmann et al. 2000). CPP-like genes play an important role in development of reproductive tissue and control of cell division in plants.

Literature:

Sequences:

CDS Sequence:
  • >ORUFI04G03370.1|Oryza_rufipogon|CPP|ORUFI04G03370.1
    ATGGGCCACGCACGCCTCCATTTCCTCCTCTTCCTCGTGAGCGCGAGCGCCGATTGCCTTCTCCGGCCGCCTCTTCGTCTCCGCCGCACCTCGGCTCCCTTAAGGATGTCCAAGCGCCTGGAACTTGTGTGTGAATGCCTCAAGCACGAGGTGAGGTGCACTGCTAAATGCCGGTGTATAGAATGCGGAAACGGACTTGGAATAAAGAGGGGAAAATGA
Protein Sequence:
  • >ORUFI04G03370.1|Oryza_rufipogon|CPP|ORUFI04G03370.1
    MGHARLHFLLFLVSASADCLLRPPLRLRRTSAPLRMSKRLELVCECLKHEVRCTAKCRCIECGNGLGIKRGK