Gene Details:

Protein Features:

Annotation Proteins:

  • Refseq:  XP_004963115.1  — protein tesmin/TSO1-like CXC 7
  • Swissprot:  Q9LUI3  — TSO1_ARATH; CRC domain-containing protein TSO1
  • TrEMBL:  A0A3L6T465  — A0A3L6T465_PANMI; Protein tesmin/TSO1-like CXC 7
  • STRING:  OBART12G18260.1  — (Oryza barthii)

Family Introduction:

  • CPP-like (cystein-rich polycomb-like protein) proteins are members of a small transcription factor family whose typical feature is the existence of one or two similar Cys-rich domains termed the CXC domain. The members of this family are widely present in plants and animals but absent in yeast, and the CXC domains of CPP-like proteins show high conservation across species from amoebae though plants to mammals (Andersen et al. 2007; Riechmann et al. 2000). CPP-like genes play an important role in development of reproductive tissue and control of cell division in plants.

Literature:

Sequences:

CDS Sequence:
  • >Oropetium_20150105_18199A|Oropetium_thomaeum|CPP|Oropetium_20150105_18199A
    ATGCATGATGCTTTGCACATAGAAGAGGCTATCAGGGCTTCTGGTCCAGTTAGACATGACCTGCCGGAAAGATCCCTCATTGATATTTATAGAAAATGCACTTGCAAGAAGTCAGCCTGCCTTAAGAAGTACTGTGACTGCTTCCAGGGGAAGGCAGGGTGCTCAATCAACTGTAAATGCGAGGATTGTAAGAACCCGTTTGGGAGAAAAGGTAAGGCTTTTTAG
Protein Sequence:
  • >Oropetium_20150105_18199A|Oropetium_thomaeum|CPP|Oropetium_20150105_18199A
    MHDALHIEEAIRASGPVRHDLPERSLIDIYRKCTCKKSACLKKYCDCFQGKAGCSINCKCEDCKNPFGRKGKAF*