Gene Details:

  • Gene ID: Jcr4S00336.60
  • Gene Family: CPP Family
  • Description: CPP Family protein
  • Species: Jatropha curcas
  • Source: CPP family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_020535281.1  — protein tesmin/TSO1-like CXC 3 isoform X1
  • Refseq:  XP_020535282.1  — protein tesmin/TSO1-like CXC 3 isoform X2
  • Refseq:  XP_020535283.1  — protein tesmin/TSO1-like CXC 3 isoform X3
  • Refseq:  XP_020535284.1  — protein tesmin/TSO1-like CXC 3 isoform X4
  • Swissprot:  F4JIF5  — TCX2_ARATH; Protein tesmin/TSO1-like CXC 2
  • TrEMBL:  B9RV08  — B9RV08_RICCO; Tso1, putative
  • STRING:  XP_002517577.1  — (Ricinus communis)

Family Introduction:

  • CPP-like (cystein-rich polycomb-like protein) proteins are members of a small transcription factor family whose typical feature is the existence of one or two similar Cys-rich domains termed the CXC domain. The members of this family are widely present in plants and animals but absent in yeast, and the CXC domains of CPP-like proteins show high conservation across species from amoebae though plants to mammals (Andersen et al. 2007; Riechmann et al. 2000). CPP-like genes play an important role in development of reproductive tissue and control of cell division in plants.

Literature:

Sequences:

CDS Sequence:
  • >Jcr4S00336.60|Jatropha_curcas|CPP|Jcr4S00336.60
    ATGGTTTGCTATATTTCTAGAAAAAGAACAAAGCCCGTCGATGACAGTGAGGGTTGCCGACGTTGCAACTGTAAGAGGTCAAAATGCTTGAAACTTTATTGTGAGTGCTTTGCAGCTGGAGTTTATTGTGTACGCAGTTGCACATGTGAAAACTGCTTCAACAGGCCCGAATATGAGGACACAGTTCTTGATACACGACAACAAATTCAAGCCCGTAATCCACTTGCCTTTGCTCCAAAAGTTGTTATACCTGGCATGAATTCTCCAGCAAACTTGCTGGAGGATGGGAACTGGACGACACCTTCATCAGCCAGGCACAAAAGAGGATGTAATTGCAAGAAATCAAAGTGTCTTAAAAAATATTGCGAATGTTATCAGGCTAAAGTTGGATGCTCCAGTGGATGCCGGTGTGAAGGTTGTAATAATTCCTTTGGCAAAAAGACA
Protein Sequence:
  • >Jcr4S00336.60|Jatropha_curcas|CPP|Jcr4S00336.60
    MVCYISRKRTKPVDDSEGCRRCNCKRSKCLKLYCECFAAGVYCVRSCTCENCFNRPEYEDTVLDTRQQIQARNPLAFAPKVVIPGMNSPANLLEDGNWTTPSSARHKRGCNCKKSKCLKKYCECYQAKVGCSSGCRCEGCNNSFGKKT