Gene Details:

  • Gene ID: gw1.2.725.1
  • Gene Name: COCSUDRAFT_9768
  • Gene Family: CPP Family
  • Description: CPP Family protein
  • Species: Coccomyxa subellipsoidea C-169
  • Source: CPP family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_005651426.1  — hypothetical protein COCSUDRAFT_9768, partial
  • Swissprot:  A1Z9E2  — LIN54_DROME; Protein lin-54 homolog
  • TrEMBL:  I0Z8B3  — I0Z8B3_COCSC; Uncharacterized protein (Fragment)
  • STRING:  XP_005651426.1  — (Coccomyxa subellipsoidea)

Family Introduction:

  • CPP-like (cystein-rich polycomb-like protein) proteins are members of a small transcription factor family whose typical feature is the existence of one or two similar Cys-rich domains termed the CXC domain. The members of this family are widely present in plants and animals but absent in yeast, and the CXC domains of CPP-like proteins show high conservation across species from amoebae though plants to mammals (Andersen et al. 2007; Riechmann et al. 2000). CPP-like genes play an important role in development of reproductive tissue and control of cell division in plants.

Literature:

Sequences:

CDS Sequence:
  • >gw1.2.725.1|Coccomyxa_subellipsoidea_C-169|CPP|gw1.2.725.1
    TGCCTGAAACTCTACTGCGATTGCTTCGCCACTGGGCTGTTCTGCAACGACGCGTGCATGTGCAAAGACTGCGAGAACCGCACCGACACGCTCAACGCAGTGTTCAAGGCGCGCAAGTTCATCATGGTCAAGGACCCCACCGCCTTCAAGCCGAAGGTGCTGGACGCCAGCGGGGGCCATGTCAAGGGCTGCGCCTGCCGCAAGTCGCGCTGCCTCAAGAAGTACTGCGAGTGCTTCCTCGTC
Protein Sequence:
  • >gw1.2.725.1|Coccomyxa_subellipsoidea_C-169|CPP|gw1.2.725.1
    CLKLYCDCFATGLFCNDACMCKDCENRTDTLNAVFKARKFIMVKDPTAFKPKVLDASGGHVKGCACRKSRCLKKYCECFLV