Gene Details:

  • Gene ID: Gorai.006G016100.1
  • Gene Name: B456_006G016100
  • Gene Family: CPP Family
  • Description: CPP Family protein
  • Species: Gossypium raimondii
  • Source: CPP family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_012483597.1  — PREDICTED: uncharacterized protein LOC105798177 isoform X1
  • Refseq:  XP_012483599.1  — PREDICTED: uncharacterized protein LOC105798177 isoform X2
  • Refseq:  XP_012483600.1  — PREDICTED: protein tesmin/TSO1-like CXC 7 isoform X3
  • Swissprot:  Q8L548  — TCX3_ARATH; Protein tesmin/TSO1-like CXC 3
  • TrEMBL:  A0A0D2Q1X0  — A0A0D2Q1X0_GOSRA; Uncharacterized protein
  • STRING:  Gorai.006G016100.1  — (Gossypium raimondii)

Family Introduction:

  • CPP-like (cystein-rich polycomb-like protein) proteins are members of a small transcription factor family whose typical feature is the existence of one or two similar Cys-rich domains termed the CXC domain. The members of this family are widely present in plants and animals but absent in yeast, and the CXC domains of CPP-like proteins show high conservation across species from amoebae though plants to mammals (Andersen et al. 2007; Riechmann et al. 2000). CPP-like genes play an important role in development of reproductive tissue and control of cell division in plants.

Literature:

Sequences:

CDS Sequence:
  • >Gorai.006G016100.1|Gossypium_raimondii|CPP|Gorai.006G016100.1
    ATGTTTGAAACTGGTGATGAAAACTTGATGAACACTCCATCAGCCAGGCATAAAAGGGGATGCAAATGCAAGAGGTCAAAATGCCTAAAAAAGTACTGTGAGTGCTATCGGGCTAAAGTTGGATGCTCTGACGGATGCCACTGTGAGGATTGTGACAACTCTTTTGGCAAGAAGTCAGAATCAATGTTCCAAAGAGTGGAAAAACAACAAAATCAATCTCATGAGGTGTTGAATACAACACAAGTTATGTCTGATAGCACTTTGGTCGGGATTACAAATCCGTTTTTTGAATGA
Protein Sequence:
  • >Gorai.006G016100.1|Gossypium_raimondii|CPP|Gorai.006G016100.1
    MFETGDENLMNTPSARHKRGCKCKRSKCLKKYCECYRAKVGCSDGCHCEDCDNSFGKKSESMFQRVEKQQNQSHEVLNTTQVMSDSTLVGITNPFFE*