Gene Details:
- Gene ID: Gorai.006G016100.1
- Gene Name: B456_006G016100
- Gene Family: CPP Family
- Description: CPP Family protein
- Species: Gossypium raimondii
- Source: CPP family gene from PlantTFDB
Protein Features:
Annotation Proteins:
- Refseq: XP_012483597.1 — PREDICTED: uncharacterized protein LOC105798177 isoform X1
- Refseq: XP_012483599.1 — PREDICTED: uncharacterized protein LOC105798177 isoform X2
- Refseq: XP_012483600.1 — PREDICTED: protein tesmin/TSO1-like CXC 7 isoform X3
- Swissprot: Q8L548 — TCX3_ARATH; Protein tesmin/TSO1-like CXC 3
- TrEMBL: A0A0D2Q1X0 — A0A0D2Q1X0_GOSRA; Uncharacterized protein
- STRING: Gorai.006G016100.1 — (Gossypium raimondii)
Family Introduction:
- CPP-like (cystein-rich polycomb-like protein) proteins are members of a small transcription factor family whose typical feature is the existence of one or two similar Cys-rich domains termed the CXC domain. The members of this family are widely present in plants and animals but absent in yeast, and the CXC domains of CPP-like proteins show high conservation across species from amoebae though plants to mammals (Andersen et al. 2007; Riechmann et al. 2000). CPP-like genes play an important role in development of reproductive tissue and control of cell division in plants.
Literature:
- Molecular evolution of the CPP-like gene family in plants: insights from comparative genomics of Arabidopsis and rice. DOI: 10.1007/s00239-008-9143-z ; PMID: 18696028
Sequences:
CDS Sequence:
- >Gorai.006G016100.1|Gossypium_raimondii|CPP|Gorai.006G016100.1
ATGTTTGAAACTGGTGATGAAAACTTGATGAACACTCCATCAGCCAGGCATAAAAGGGGATGCAAATGCAAGAGGTCAAAATGCCTAAAAAAGTACTGTGAGTGCTATCGGGCTAAAGTTGGATGCTCTGACGGATGCCACTGTGAGGATTGTGACAACTCTTTTGGCAAGAAGTCAGAATCAATGTTCCAAAGAGTGGAAAAACAACAAAATCAATCTCATGAGGTGTTGAATACAACACAAGTTATGTCTGATAGCACTTTGGTCGGGATTACAAATCCGTTTTTTGAATGA
Protein Sequence:
- >Gorai.006G016100.1|Gossypium_raimondii|CPP|Gorai.006G016100.1
MFETGDENLMNTPSARHKRGCKCKRSKCLKKYCECYRAKVGCSDGCHCEDCDNSFGKKSESMFQRVEKQQNQSHEVLNTTQVMSDSTLVGITNPFFE*