Gene Details:

  • Gene ID: Glyma.18G224100.1.p
  • Gene Name: GLYMA_18G224100
  • Gene Family: CPP Family
  • Description: CPP Family protein
  • Species: Glycine max
  • Source: CPP family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_025982093.1  — cysteine-rich polycomb-like protein isoform X1
  • Refseq:  XP_025982094.1  — cysteine-rich polycomb-like protein isoform X1
  • Swissprot:  Q9LUI3  — TSO1_ARATH; CRC domain-containing protein TSO1
  • TrEMBL:  K7MU27  — K7MU27_SOYBN; Uncharacterized protein
  • STRING:  GLYMA18G45736.1  — (Glycine max)

Family Introduction:

  • CPP-like (cystein-rich polycomb-like protein) proteins are members of a small transcription factor family whose typical feature is the existence of one or two similar Cys-rich domains termed the CXC domain. The members of this family are widely present in plants and animals but absent in yeast, and the CXC domains of CPP-like proteins show high conservation across species from amoebae though plants to mammals (Andersen et al. 2007; Riechmann et al. 2000). CPP-like genes play an important role in development of reproductive tissue and control of cell division in plants.

Literature:

Sequences:

CDS Sequence:
  • >Glyma.18G224100.1.p|Glycine_max|CPP|Glyma.18G224100.1.p
    ATGGATGATGAAAATCTGACAACACCATCATCGGCAAGGCACAAAAGTGGTTGCAATTACAAAAGGTCAATGTGTCTGAAAAAATATTGTGAATGTTATCAGGCTAATGTTGGATGCTCTAGTGGATGCCAATGTGAGGGATGTAATGTCCATGGCAAGAAAGAAGATTATGTTGCATTTGAACATACTTCGAGTAAAGAAAGGGTGAGCAGTATTGTTGAAGAAGGATCAGCCCACACTTTTCACAATAAACTGGAAATGGTGGCTAGCAAGACTGTTTATGATTCACTGCCTCTCACCTATAACGCCATCATTGCAATGCTCTGA
Protein Sequence:
  • >Glyma.18G224100.1.p|Glycine_max|CPP|Glyma.18G224100.1.p
    MDDENLTTPSSARHKSGCNYKRSMCLKKYCECYQANVGCSSGCQCEGCNVHGKKEDYVAFEHTSSKERVSSIVEEGSAHTFHNKLEMVASKTVYDSLPLTYNAIIAML*