Gene Details:
- Gene ID: EcC034133.10
- Gene Family: CPP Family
- Description: CPP Family protein
- Species: Eucalyptus camaldulensis
- Source: CPP family gene from PlantTFDB
Protein Features:
Annotation Proteins:
- Refseq: XP_018717839.1 — PREDICTED: protein tesmin/TSO1-like CXC 2
- Swissprot: F4JIF5 — TCX2_ARATH; Protein tesmin/TSO1-like CXC 2
- TrEMBL: A0A200Q4M6 — A0A200Q4M6_9MAGN; CRC domain
- TrEMBL: A0A2C9UCH4 — A0A2C9UCH4_MANES; Uncharacterized protein
- TrEMBL: A0A2I4EGY2 — A0A2I4EGY2_JUGRE; protein tesmin/TSO1-like CXC 2 isoform X4
- TrEMBL: A0A2K3LG93 — A0A2K3LG93_TRIPR; Tesmin/TSO1-like CXC domain protein (Fragment)
- TrEMBL: A0A392M932 — A0A392M932_9FABA; Tesmin/TSO1-like CXC domain protein (Fragment)
- STRING: XP_010030274.1 — (Eucalyptus grandis)
Gene Ontology:
- GO:0005975 — Biological Process — carbohydrate metabolic process
- GO:0004553 — Molecular Function — hydrolase activity, hydrolyzing O-glycosyl compounds
Family Introduction:
- CPP-like (cystein-rich polycomb-like protein) proteins are members of a small transcription factor family whose typical feature is the existence of one or two similar Cys-rich domains termed the CXC domain. The members of this family are widely present in plants and animals but absent in yeast, and the CXC domains of CPP-like proteins show high conservation across species from amoebae though plants to mammals (Andersen et al. 2007; Riechmann et al. 2000). CPP-like genes play an important role in development of reproductive tissue and control of cell division in plants.
Literature:
- Molecular evolution of the CPP-like gene family in plants: insights from comparative genomics of Arabidopsis and rice. DOI: 10.1007/s00239-008-9143-z ; PMID: 18696028
Sequences:
CDS Sequence:
- >EcC034133.10|Eucalyptus_camaldulensis|CPP|EcC034133.10
ATATTGCGAATGCTTTGCAGCGGAACTTTTCTGTACCGACAGTTGTACATGTGGATTCTGCTACAACAACCGTGACATGGAAGACTCAGTTTACAAGGCAAAGGAGCTGATTAAATTGCATAATCCTCTTGCATTCGGTCCAAAGGTAGTTCGGCATCCCGAAAGTGGTGGTCGTGTTGGTGGTAGGAGTGAGGACACCCCATCATTCGTGAGGCACAAACGCGGATGTAATTGCAAGAAGTCTCAGTGCCTGAAAAATTACTGCGAGTGCTATCAGGGCAAAGCTGGATGTTTCCATGAATGCAACTGCCGAGATTGCTCTAACCCTTTTGGCCCGAAATCAG
Protein Sequence:
- >EcC034133.10|Eucalyptus_camaldulensis|CPP|EcC034133.10
YCECFAAELFCTDSCTCGFCYNNRDMEDSVYKAKELIKLHNPLAFGPKVVRHPESGGRVGGRSEDTPSFVRHKRGCNCKKSQCLKNYCECYQGKAGCFHECNCRDCSNPFGPKS