Gene Details:

  • Gene ID: EcC034133.10
  • Gene Family: CPP Family
  • Description: CPP Family protein
  • Species: Eucalyptus camaldulensis
  • Source: CPP family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_018717839.1  — PREDICTED: protein tesmin/TSO1-like CXC 2
  • Swissprot:  F4JIF5  — TCX2_ARATH; Protein tesmin/TSO1-like CXC 2
  • TrEMBL:  A0A200Q4M6  — A0A200Q4M6_9MAGN; CRC domain
  • TrEMBL:  A0A2C9UCH4  — A0A2C9UCH4_MANES; Uncharacterized protein
  • TrEMBL:  A0A2I4EGY2  — A0A2I4EGY2_JUGRE; protein tesmin/TSO1-like CXC 2 isoform X4
  • TrEMBL:  A0A2K3LG93  — A0A2K3LG93_TRIPR; Tesmin/TSO1-like CXC domain protein (Fragment)
  • TrEMBL:  A0A392M932  — A0A392M932_9FABA; Tesmin/TSO1-like CXC domain protein (Fragment)
  • STRING:  XP_010030274.1  — (Eucalyptus grandis)

Gene Ontology:

  • GO:0005975  — Biological Process — carbohydrate metabolic process
  • GO:0004553  — Molecular Function — hydrolase activity, hydrolyzing O-glycosyl compounds

Family Introduction:

  • CPP-like (cystein-rich polycomb-like protein) proteins are members of a small transcription factor family whose typical feature is the existence of one or two similar Cys-rich domains termed the CXC domain. The members of this family are widely present in plants and animals but absent in yeast, and the CXC domains of CPP-like proteins show high conservation across species from amoebae though plants to mammals (Andersen et al. 2007; Riechmann et al. 2000). CPP-like genes play an important role in development of reproductive tissue and control of cell division in plants.

Literature:

Sequences:

CDS Sequence:
  • >EcC034133.10|Eucalyptus_camaldulensis|CPP|EcC034133.10
    ATATTGCGAATGCTTTGCAGCGGAACTTTTCTGTACCGACAGTTGTACATGTGGATTCTGCTACAACAACCGTGACATGGAAGACTCAGTTTACAAGGCAAAGGAGCTGATTAAATTGCATAATCCTCTTGCATTCGGTCCAAAGGTAGTTCGGCATCCCGAAAGTGGTGGTCGTGTTGGTGGTAGGAGTGAGGACACCCCATCATTCGTGAGGCACAAACGCGGATGTAATTGCAAGAAGTCTCAGTGCCTGAAAAATTACTGCGAGTGCTATCAGGGCAAAGCTGGATGTTTCCATGAATGCAACTGCCGAGATTGCTCTAACCCTTTTGGCCCGAAATCAG
Protein Sequence:
  • >EcC034133.10|Eucalyptus_camaldulensis|CPP|EcC034133.10
    YCECFAAELFCTDSCTCGFCYNNRDMEDSVYKAKELIKLHNPLAFGPKVVRHPESGGRVGGRSEDTPSFVRHKRGCNCKKSQCLKNYCECYQGKAGCFHECNCRDCSNPFGPKS