Gene Details:

  • Gene ID: EcC033159.30
  • Gene Family: CPP Family
  • Description: CPP Family protein
  • Species: Eucalyptus camaldulensis
  • Source: CPP family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_018717839.1  — PREDICTED: protein tesmin/TSO1-like CXC 2
  • TrEMBL:  A0A1U7ZN45  — A0A1U7ZN45_NELNU; uncharacterized protein LOC104592360 isoform X1
  • TrEMBL:  A0A1U7ZPH6  — A0A1U7ZPH6_NELNU; uncharacterized protein LOC104592360 isoform X2
  • STRING:  XP_010030274.1  — (Eucalyptus grandis)

Gene Ontology:

  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • CPP-like (cystein-rich polycomb-like protein) proteins are members of a small transcription factor family whose typical feature is the existence of one or two similar Cys-rich domains termed the CXC domain. The members of this family are widely present in plants and animals but absent in yeast, and the CXC domains of CPP-like proteins show high conservation across species from amoebae though plants to mammals (Andersen et al. 2007; Riechmann et al. 2000). CPP-like genes play an important role in development of reproductive tissue and control of cell division in plants.

Literature:

Sequences:

CDS Sequence:
  • >EcC033159.30|Eucalyptus_camaldulensis|CPP|EcC033159.30
    GAAGAAAGCAGAAAATGCCACAGAGAATGGAAGCACGAAAAGATGCAGTTGCAGGAGATCCAAATGCTTGCAACTATTTTGCGAATGCTTTGTAGCGGAACTTTTCTGTACCGACAGTTGTGCATGTAGACTCTGCTACAACAACCGTGACATGGAAGACTCAGTTTACAAGGCAAAGGAGCTGATTAAATTGCATAATCCTCTTGCATTCGGTCCGAAGGTAGTTCAGCATCCCACCGATTCGCCTCCAGATAAAGCGGAAAGTGGTGGTCGTGTTGGTGGTAGGAGTGAGGACACCCCATCATTCGTGAGGCACAAACGCGGATGTAATTGCAAGAAGTCTCAGTGCCTGAAAAATTACTGCGAGTGCTATCAG
Protein Sequence:
  • >EcC033159.30|Eucalyptus_camaldulensis|CPP|EcC033159.30
    KKAENATENGSTKRCSCRRSKCLQLFCECFVAELFCTDSCACRLCYNNRDMEDSVYKAKELIKLHNPLAFGPKVVQHPTDSPPDKAESGGRVGGRSEDTPSFVRHKRGCNCKKSQCLKNYCECYQ