Gene Details:
- Gene ID: EcC033159.30
- Gene Family: CPP Family
- Description: CPP Family protein
- Species: Eucalyptus camaldulensis
- Source: CPP family gene from PlantTFDB
Protein Features:
Annotation Proteins:
- Refseq: XP_018717839.1 — PREDICTED: protein tesmin/TSO1-like CXC 2
- TrEMBL: A0A1U7ZN45 — A0A1U7ZN45_NELNU; uncharacterized protein LOC104592360 isoform X1
- TrEMBL: A0A1U7ZPH6 — A0A1U7ZPH6_NELNU; uncharacterized protein LOC104592360 isoform X2
- STRING: XP_010030274.1 — (Eucalyptus grandis)
Gene Ontology:
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0003677 — Molecular Function — DNA binding
Family Introduction:
- CPP-like (cystein-rich polycomb-like protein) proteins are members of a small transcription factor family whose typical feature is the existence of one or two similar Cys-rich domains termed the CXC domain. The members of this family are widely present in plants and animals but absent in yeast, and the CXC domains of CPP-like proteins show high conservation across species from amoebae though plants to mammals (Andersen et al. 2007; Riechmann et al. 2000). CPP-like genes play an important role in development of reproductive tissue and control of cell division in plants.
Literature:
- Molecular evolution of the CPP-like gene family in plants: insights from comparative genomics of Arabidopsis and rice. DOI: 10.1007/s00239-008-9143-z ; PMID: 18696028
Sequences:
CDS Sequence:
- >EcC033159.30|Eucalyptus_camaldulensis|CPP|EcC033159.30
GAAGAAAGCAGAAAATGCCACAGAGAATGGAAGCACGAAAAGATGCAGTTGCAGGAGATCCAAATGCTTGCAACTATTTTGCGAATGCTTTGTAGCGGAACTTTTCTGTACCGACAGTTGTGCATGTAGACTCTGCTACAACAACCGTGACATGGAAGACTCAGTTTACAAGGCAAAGGAGCTGATTAAATTGCATAATCCTCTTGCATTCGGTCCGAAGGTAGTTCAGCATCCCACCGATTCGCCTCCAGATAAAGCGGAAAGTGGTGGTCGTGTTGGTGGTAGGAGTGAGGACACCCCATCATTCGTGAGGCACAAACGCGGATGTAATTGCAAGAAGTCTCAGTGCCTGAAAAATTACTGCGAGTGCTATCAG
Protein Sequence:
- >EcC033159.30|Eucalyptus_camaldulensis|CPP|EcC033159.30
KKAENATENGSTKRCSCRRSKCLQLFCECFVAELFCTDSCACRLCYNNRDMEDSVYKAKELIKLHNPLAFGPKVVQHPTDSPPDKAESGGRVGGRSEDTPSFVRHKRGCNCKKSQCLKNYCECYQ