Gene Details:

  • Gene ID: Csa05952s010.1
  • Gene Family: CPP Family
  • Description: CPP Family protein
  • Species: Camelina sativa
  • Source: CPP family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_010440393.1  — PREDICTED: protein tesmin/TSO1-like CXC 2
  • Refseq:  XP_019089594.1  — PREDICTED: protein tesmin/TSO1-like CXC 2 isoform X1
  • Refseq:  XP_019089595.1  — PREDICTED: protein tesmin/TSO1-like CXC 2 isoform X2
  • Swissprot:  F4JIF5  — TCX2_ARATH; Protein tesmin/TSO1-like CXC 2
  • TrEMBL:  A0A178UVP4  — A0A178UVP4_ARATH; TCX2
  • TrEMBL:  A0A1P8B4Y7  — A0A1P8B4Y7_ARATH; TESMIN/TSO1-like CXC 2
  • TrEMBL:  A0A1P8B4Z6  — A0A1P8B4Z6_ARATH; TESMIN/TSO1-like CXC 2
  • TrEMBL:  R0F1B1  — R0F1B1_9BRAS; Uncharacterized protein
  • STRING:  XP_010440393.1  — (Camelina sativa)

Family Introduction:

  • CPP-like (cystein-rich polycomb-like protein) proteins are members of a small transcription factor family whose typical feature is the existence of one or two similar Cys-rich domains termed the CXC domain. The members of this family are widely present in plants and animals but absent in yeast, and the CXC domains of CPP-like proteins show high conservation across species from amoebae though plants to mammals (Andersen et al. 2007; Riechmann et al. 2000). CPP-like genes play an important role in development of reproductive tissue and control of cell division in plants.

Literature:

Sequences:

CDS Sequence:
  • >Csa05952s010.1|Camelina_sativa|CPP|Csa05952s010.1
    AATGAAACCCGGGAAGATGCAGATCAAGATGTTCCCGTTGAACCAGCCTTGCAAGAGTTGAATTTGAGCAGCCCTAAGAAGAAGAGAGTTAAGTTGGATTCTGGAGAAGGCGACTCGTGTAAGAGATGCAACTGCAAAAAGTCCAAGTGTTTGAAACTCTATTGTGAATGTTTTGCTGCTGGAGTCTATTGCATAGAGCCATGTTCATGTATAGACTGCTTCAATAAGCCTATTCATGAAGATACTGTCTTGGCTACTCGAAAACAGATTGAATCTCGGAATCCACTTGCATTTGCTCCTAAAGTCATTAGGAACTCTGACTCGGTTCTTGAAACCGGG
Protein Sequence:
  • >Csa05952s010.1|Camelina_sativa|CPP|Csa05952s010.1
    NETREDADQDVPVEPALQELNLSSPKKKRVKLDSGEGDSCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCIDCFNKPIHEDTVLATRKQIESRNPLAFAPKVIRNSDSVLETG