Gene Details:
- Gene ID: Cotton_A_11632_BGI-A2_v1.0
- Gene Family: CPP Family
- Description: CPP Family protein
- Species: Gossypium arboreum
- Source: CPP family gene from PlantTFDB
Protein Features:
Annotation Proteins:
- Refseq: XP_012480682.1 — PREDICTED: uncharacterized protein LOC105795543 isoform X1
- Refseq: XP_012480684.1 — PREDICTED: uncharacterized protein LOC105795543 isoform X3
- Refseq: XP_012480686.1 — PREDICTED: uncharacterized protein LOC105795543 isoform X5
- Swissprot: F4JIF5 — TCX2_ARATH; Protein tesmin/TSO1-like CXC 2
- Swissprot: Q9LUI3 — TSO1_ARATH; CRC domain-containing protein TSO1
- TrEMBL: A0A2P5S5T1 — A0A2P5S5T1_GOSBA; Uncharacterized protein
- STRING: XP_006465501.1 — (Citrus sinensis)
Family Introduction:
- CPP-like (cystein-rich polycomb-like protein) proteins are members of a small transcription factor family whose typical feature is the existence of one or two similar Cys-rich domains termed the CXC domain. The members of this family are widely present in plants and animals but absent in yeast, and the CXC domains of CPP-like proteins show high conservation across species from amoebae though plants to mammals (Andersen et al. 2007; Riechmann et al. 2000). CPP-like genes play an important role in development of reproductive tissue and control of cell division in plants.
Literature:
- Molecular evolution of the CPP-like gene family in plants: insights from comparative genomics of Arabidopsis and rice. DOI: 10.1007/s00239-008-9143-z ; PMID: 18696028
Sequences:
CDS Sequence:
- >Cotton_A_11632_BGI-A2_v1.0|Gossypium_arboreum|CPP|Cotton_A_11632_BGI-A2_v1.0
ATGGAGGATTCTCAGAAAGTGTCATGGTTGACCAACTATCCAAATCCCAAGATAGCTCAAAAGGGAAGAGGCAAGAATAGAGAAACATTCCCAGATGAGACTGAAGCCTGTAAACACTGCAACCGTAGAAGATCCAGATGTTTGAAACTTTACTGTGAGTGCTTTGCAGCAGGGATTTACTGCGAGGATTGTTGTGCATGTGAGAACTGTTTGAACAAGCCAGATTATGAAGAGGTTGTTCTTGATTTTTGA
Protein Sequence:
- >Cotton_A_11632_BGI-A2_v1.0|Gossypium_arboreum|CPP|Cotton_A_11632_BGI-A2_v1.0
MEDSQKVSWLTNYPNPKIAQKGRGKNRETFPDETEACKHCNRRRSRCLKLYCECFAAGIYCEDCCACENCLNKPDYEEVVLDF