Gene Details:

Protein Features:

Annotation Proteins:

  • Refseq:  XP_012480682.1  — PREDICTED: uncharacterized protein LOC105795543 isoform X1
  • Refseq:  XP_012480684.1  — PREDICTED: uncharacterized protein LOC105795543 isoform X3
  • Refseq:  XP_012480686.1  — PREDICTED: uncharacterized protein LOC105795543 isoform X5
  • Swissprot:  F4JIF5  — TCX2_ARATH; Protein tesmin/TSO1-like CXC 2
  • Swissprot:  Q9LUI3  — TSO1_ARATH; CRC domain-containing protein TSO1
  • TrEMBL:  A0A2P5S5T1  — A0A2P5S5T1_GOSBA; Uncharacterized protein
  • STRING:  XP_006465501.1  — (Citrus sinensis)

Family Introduction:

  • CPP-like (cystein-rich polycomb-like protein) proteins are members of a small transcription factor family whose typical feature is the existence of one or two similar Cys-rich domains termed the CXC domain. The members of this family are widely present in plants and animals but absent in yeast, and the CXC domains of CPP-like proteins show high conservation across species from amoebae though plants to mammals (Andersen et al. 2007; Riechmann et al. 2000). CPP-like genes play an important role in development of reproductive tissue and control of cell division in plants.

Literature:

Sequences:

CDS Sequence:
  • >Cotton_A_11632_BGI-A2_v1.0|Gossypium_arboreum|CPP|Cotton_A_11632_BGI-A2_v1.0
    ATGGAGGATTCTCAGAAAGTGTCATGGTTGACCAACTATCCAAATCCCAAGATAGCTCAAAAGGGAAGAGGCAAGAATAGAGAAACATTCCCAGATGAGACTGAAGCCTGTAAACACTGCAACCGTAGAAGATCCAGATGTTTGAAACTTTACTGTGAGTGCTTTGCAGCAGGGATTTACTGCGAGGATTGTTGTGCATGTGAGAACTGTTTGAACAAGCCAGATTATGAAGAGGTTGTTCTTGATTTTTGA
Protein Sequence:
  • >Cotton_A_11632_BGI-A2_v1.0|Gossypium_arboreum|CPP|Cotton_A_11632_BGI-A2_v1.0
    MEDSQKVSWLTNYPNPKIAQKGRGKNRETFPDETEACKHCNRRRSRCLKLYCECFAAGIYCEDCCACENCLNKPDYEEVVLDF