Gene Details:

  • Gene ID: AA131G00001
  • Gene Family: CPP Family
  • Description: CPP Family protein
  • Species: Aethionema arabicum
  • Source: CPP family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_009145268.1  — PREDICTED: CRC domain-containing protein TSO1
  • Swissprot:  F4JIF5  — TCX2_ARATH; Protein tesmin/TSO1-like CXC 2
  • TrEMBL:  A0A397ZBQ0  — A0A397ZBQ0_BRACM; Uncharacterized protein
  • STRING:  Bra033919.1-P  — (Brassica rapa)
  • STRING:  Bo5g094500.1  — (Brassica oleracea)

Family Introduction:

  • CPP-like (cystein-rich polycomb-like protein) proteins are members of a small transcription factor family whose typical feature is the existence of one or two similar Cys-rich domains termed the CXC domain. The members of this family are widely present in plants and animals but absent in yeast, and the CXC domains of CPP-like proteins show high conservation across species from amoebae though plants to mammals (Andersen et al. 2007; Riechmann et al. 2000). CPP-like genes play an important role in development of reproductive tissue and control of cell division in plants.

Literature:

Sequences:

CDS Sequence:
  • >AA131G00001|Aethionema_arabicum|CPP|AA131G00001
    ATGACTACACGTAAAAATATCGAATCTCGGAACCCAAATGCATTTGCTCCTAAATTCATCAAGACTCCAGCTTCTGCGCGACATAAACGTGGTTGTAACTGCAACAAATCCAAATGTTTCAACAAACACTGCGAATGCTTTCAGGCTGGTGTTGGCTGTTCACTAAACTGTAGATGTGAAGGATGCAAGAATTGGTTTGGTCCCAAAGATGCT
Protein Sequence:
  • >AA131G00001|Aethionema_arabicum|CPP|AA131G00001
    MTTRKNIESRNPNAFAPKFIKTPASARHKRGCNCNKSKCFNKHCECFQAGVGCSLNCRCEGCKNWFGPKDA