Gene Details:

  • Gene ID: 462876063
  • Gene Family: CPP Family
  • Description: CPP Family protein
  • Species: Eragrostis tef
  • Source: CPP family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_004969151.1  — protein tesmin/TSO1-like CXC 3 isoform X1
  • TrEMBL:  A0A368R9B5  — A0A368R9B5_SETIT; Uncharacterized protein
  • TrEMBL:  K3XLU8  — K3XLU8_SETIT; Uncharacterized protein
  • STRING:  Si002871m  — (Setaria italica)

Family Introduction:

  • CPP-like (cystein-rich polycomb-like protein) proteins are members of a small transcription factor family whose typical feature is the existence of one or two similar Cys-rich domains termed the CXC domain. The members of this family are widely present in plants and animals but absent in yeast, and the CXC domains of CPP-like proteins show high conservation across species from amoebae though plants to mammals (Andersen et al. 2007; Riechmann et al. 2000). CPP-like genes play an important role in development of reproductive tissue and control of cell division in plants.

Literature:

Sequences:

CDS Sequence:
  • >462876063|Eragrostis_tef|CPP|462876063
    ATGGGCGACGATGAGGGGCCGCGGCCGAGCTGCAGCTGCAGGAACGCCCGCTGCATCCAGCGGTACTGCCATTGCTTCGGCAACCGGTGGTACTGCTCCGACGCTTGCAGATGCGAGGCCTGCTGGAACACGGAGTCCAGGGCGGCCTTCGTGGAGGAGCGCGCCGAGATTATCCTCAAGAACAAGCCTGGCGCCTTCCAGTCCAAGATTGCCCGCGACGGAGACCCCTCCGTCCCGGGAAAAGAGCAGAGGAGGCATGTGAAGGGTTGCACCTGCCGCAAGTCGGAGTGCAGGAAGAACTACTGCGAGTGTTTCAAGTGGTAG
Protein Sequence:
  • >462876063|Eragrostis_tef|CPP|462876063
    MGDDEGPRPSCSCRNARCIQRYCHCFGNRWYCSDACRCEACWNTESRAAFVEERAEIILKNKPGAFQSKIARDGDPSVPGKEQRRHVKGCTCRKSECRKNYCECFKW