Gene Details:

  • Gene ID: Neem_1178_f_2
  • Gene Family: CO-like Family
  • Description: CO-like Family protein
  • Species: Azadirachta indica
  • Source: CO-like family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_006447848.1  — zinc finger protein CONSTANS-LIKE 9
  • Refseq:  XP_006469416.1  — zinc finger protein CONSTANS-LIKE 9
  • Refseq:  XP_015382901.1  — zinc finger protein CONSTANS-LIKE 9
  • Refseq:  XP_024951289.1  — zinc finger protein CONSTANS-LIKE 9
  • Swissprot:  Q9SSE5  — COL9_ARATH; Zinc finger protein CONSTANS-LIKE 9
  • TrEMBL:  V4U567  — V4U567_9ROSI; Uncharacterized protein
  • STRING:  XP_006469416.1  — (Citrus sinensis)
  • STRING:  XP_006447847.1  — (Citrus clementina)

Gene Ontology:

  • GO:0007623  — Biological Process — circadian rhythm
  • GO:0048579  — Biological Process — negative regulation of long-day photoperiodism, flowering
  • GO:0005634  — Cellular Component — nucleus
  • GO:0005515  — Molecular Function — protein binding
  • GO:0008270  — Molecular Function — zinc ion binding

Family Introduction:

  • CO(CONSTANS) gene acts between the circadian clock and genes controlling meristem identity.In Arabidopsis, CO transcription factors defined by two conserved domains. The first is a zinc finger region near the amino terminus that resembles B-boxes, which regulate protein-protein interactions in several animal transcription factors. The second is a region of 43 amino acids near the carboxy terminus termed the CCT (CO, CO-like, TOC1) domain. Studies using green fluorescent protein fusions show that the CCT domain is involved in nuclear localization of the CO protein but must have an additional role because the late-flowering co-7 mutant, which has an altered CCT domain, correctly localizes the protein.

Literature:

Sequences:

CDS Sequence:
  • >Neem_1178_f_2|Azadirachta_indica|CO-like|Neem_1178_f_2
Protein Sequence:
  • >Neem_1178_f_2|Azadirachta_indica|CO-like|Neem_1178_f_2
    MGYMCDFCGDQRSIVYCRSDAACLCLSCDRNVHSANALSKRHSRTLLCERCNSQPALVRCAEERVSLCQNCDWIGHGTSTSDSTHKRQTINCYSGCPSAAELSSIWSFVLDVQSVGESACEQELGLMSITDDSTKNSFGPNEDTISQNISGGGVEANDVCDLDKSNVWVGTSSVPGLNSAKQNLEQTPASANNPTLPKLCCSGTKGLVFCEDDDLYEDFNMDEVGLNFENYEELFGVTLNHSEELLENGGIDSLFGTKDMSAADSNCQGAVAAEGSSVGLVNAIQPACSNAASADSMMSTKTEPILCFTAKQAHSSLSFSGLTGDSNPGDYQDCDASSMLLMGEPPWCPPCPETTYTSASRSKAVMRYKEKKKTRKFDKRVRYASRKARADVRKRVKGRFVKAGDAYDYDPLNQTRSC