Gene Details:
- Gene ID: cra_locus_6793_iso_2
- Gene Family: CO-like Family
- Description: CO-like Family protein
- Species: Catharanthus roseus
- Source: CO-like family gene from PlantTFDB
Protein Features:
- PROSITE profile: PS50119
- SMART: SM00336
- Pfam: PF00643
- Pfam: PF06203
- PROSITE profile: PS51017
- InterPro: IPR000315 IPR010402
Annotation Proteins:
- Refseq: XP_022759198.1 — zinc finger protein CONSTANS-LIKE 2-like
- Swissprot: Q96502 — COL2_ARATH; Zinc finger protein CONSTANS-LIKE 2
- TrEMBL: C0Z3T8 — C0Z3T8_SOLTU; CONSTANS protein
- STRING: PGSC0003DMT400026065 — (Solanum tuberosum)
Gene Ontology:
- GO:0009658 — Biological Process — chloroplast organization
- GO:0009909 — Biological Process — regulation of flower development
- GO:0045892 — Biological Process — negative regulation of transcription, DNA-templated
- GO:0048576 — Biological Process — positive regulation of short-day photoperiodism, flowering
- GO:0048579 — Biological Process — negative regulation of long-day photoperiodism, flowering
- GO:0005622 — Cellular Component — intracellular
- GO:0005515 — Molecular Function — protein binding
- GO:0008270 — Molecular Function — zinc ion binding
Family Introduction:
- CO(CONSTANS) gene acts between the circadian clock and genes controlling meristem identity.In Arabidopsis, CO transcription factors defined by two conserved domains. The first is a zinc finger region near the amino terminus that resembles B-boxes, which regulate protein-protein interactions in several animal transcription factors. The second is a region of 43 amino acids near the carboxy terminus termed the CCT (CO, CO-like, TOC1) domain. Studies using green fluorescent protein fusions show that the CCT domain is involved in nuclear localization of the CO protein but must have an additional role because the late-flowering co-7 mutant, which has an altered CCT domain, correctly localizes the protein.
Literature:
- The evolution of CONSTANS-like gene families in barley, rice, and Arabidopsis. DOI: 10.1104/pp.102.016188 ; PMID: 12692345
Sequences:
CDS Sequence:
- >cra_locus_6793_iso_2|Catharanthus_roseus|CO-like|cra_locus_6793_iso_2
Protein Sequence:
- >cra_locus_6793_iso_2|Catharanthus_roseus|CO-like|cra_locus_6793_iso_2
GDLYTGGGGVRSNNWARACDTCRSAACTVYCKADSAYLCSGCDSRIHAANKVASRHERVWICESCEKAPAAFLCKADAASLCATCDSDIHSANPLARRHHRVPILPIPLTTGCLYGGGGGGGPMIGHTATADEVEDDFNLTPVAAGEGGDDTTIDEDDENEAASWLLLNPVKNYSSSNEHNNGQGNNNNNIGGIFGGEGVDEYLDLVDYQQEDNNQFGDHEYVVSDEKNRYGVGAAECVVPSSRNGDGKXXXXXHHHHHLHQFQNHQSFQLGLDYEISNNTGYGYPASITHTVSVSSMEVGVVPDSMMSDVSFSHPRPPKGTIDLFSSAPLQMPQQLTPMDREARVLRYREKKRTRKFEKTIRYASRKAYAETRPRIKGRFAKRTEAEIEVDQMLSTTSITENGYSIVPSF