Gene Details:

  • Gene ID: cra_locus_6793_iso_2
  • Gene Family: CO-like Family
  • Description: CO-like Family protein
  • Species: Catharanthus roseus
  • Source: CO-like family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_022759198.1  — zinc finger protein CONSTANS-LIKE 2-like
  • Swissprot:  Q96502  — COL2_ARATH; Zinc finger protein CONSTANS-LIKE 2
  • TrEMBL:  C0Z3T8  — C0Z3T8_SOLTU; CONSTANS protein
  • STRING:  PGSC0003DMT400026065  — (Solanum tuberosum)

Gene Ontology:

  • GO:0009658  — Biological Process — chloroplast organization
  • GO:0009909  — Biological Process — regulation of flower development
  • GO:0045892  — Biological Process — negative regulation of transcription, DNA-templated
  • GO:0048576  — Biological Process — positive regulation of short-day photoperiodism, flowering
  • GO:0048579  — Biological Process — negative regulation of long-day photoperiodism, flowering
  • GO:0005622  — Cellular Component — intracellular
  • GO:0005515  — Molecular Function — protein binding
  • GO:0008270  — Molecular Function — zinc ion binding

Family Introduction:

  • CO(CONSTANS) gene acts between the circadian clock and genes controlling meristem identity.In Arabidopsis, CO transcription factors defined by two conserved domains. The first is a zinc finger region near the amino terminus that resembles B-boxes, which regulate protein-protein interactions in several animal transcription factors. The second is a region of 43 amino acids near the carboxy terminus termed the CCT (CO, CO-like, TOC1) domain. Studies using green fluorescent protein fusions show that the CCT domain is involved in nuclear localization of the CO protein but must have an additional role because the late-flowering co-7 mutant, which has an altered CCT domain, correctly localizes the protein.

Literature:

Sequences:

CDS Sequence:
  • >cra_locus_6793_iso_2|Catharanthus_roseus|CO-like|cra_locus_6793_iso_2
Protein Sequence:
  • >cra_locus_6793_iso_2|Catharanthus_roseus|CO-like|cra_locus_6793_iso_2
    GDLYTGGGGVRSNNWARACDTCRSAACTVYCKADSAYLCSGCDSRIHAANKVASRHERVWICESCEKAPAAFLCKADAASLCATCDSDIHSANPLARRHHRVPILPIPLTTGCLYGGGGGGGPMIGHTATADEVEDDFNLTPVAAGEGGDDTTIDEDDENEAASWLLLNPVKNYSSSNEHNNGQGNNNNNIGGIFGGEGVDEYLDLVDYQQEDNNQFGDHEYVVSDEKNRYGVGAAECVVPSSRNGDGKXXXXXHHHHHLHQFQNHQSFQLGLDYEISNNTGYGYPASITHTVSVSSMEVGVVPDSMMSDVSFSHPRPPKGTIDLFSSAPLQMPQQLTPMDREARVLRYREKKRTRKFEKTIRYASRKAYAETRPRIKGRFAKRTEAEIEVDQMLSTTSITENGYSIVPSF