Gene Details:

  • Gene ID: Zmw_sc09537.1.g00010.1
  • Gene Family: CAMTA Family
  • Description: CAMTA Family protein
  • Species: Zoysia matrella
  • Source: CAMTA family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  NP_001352474.1  — uncharacterized protein LOC100502366
  • Swissprot:  Q7XHR2  — CBT_ORYSJ; Calmodulin-binding transcription activator CBT
  • TrEMBL:  A0A1D6IBR1  — A0A1D6IBR1_MAIZE; Calmodulin-binding transcription activator 5
  • STRING:  Pavir.J11066.1.p  — (Panicum virgatum)
  • STRING:  Sb02g033620.1  — (Sorghum bicolor)
  • STRING:  GRMZM2G032336_P01  — (Zea mays)

Gene Ontology:

  • GO:0005634  — Cellular Component — nucleus
  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • The CAMTA family of calmodulin binding transcription factors comprises six members in Arabidopsis (Bouche et al., 2002; Finkler et al., 2007). Each protein includes an IQ domain for calmodulin binding; ankyrin repeats for protein interactions; the TIG domain, which has nonspecific DNA binding activity; and the CG-1 domain, which has specific DNA binding activity. The CG-1 domain recognizes the core consensus sequence, vCGCGb, referred to as the CG-1 element (da Costa e Silva, 1994). This sequence matches the CM2 sequence, CCGCGT, and overlaps the ICEr1 element. Thus, the possibility was raised that one or more of the CAMTA proteins might have a role in regulating CBF2 expression.

Literature:

Sequences:

CDS Sequence:
  • >Zmw_sc09537.1.g00010.1|Zoysia_matrella|CAMTA|Zmw_sc09537.1.g00010.1
Protein Sequence:
  • >Zmw_sc09537.1.g00010.1|Zoysia_matrella|CAMTA|Zmw_sc09537.1.g00010.1
    GTVVLYDRKVVRNFRKDGHNWKKKKDGKTVQEAHEKLKIGNEEKVHVYYARGEDDPNFFRRCYWLLDK