Gene Details:

  • Gene ID: Zmw_sc02367.1.g00110.1
  • Gene Family: CAMTA Family
  • Description: CAMTA Family protein
  • Species: Zoysia matrella
  • Source: CAMTA family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_025793079.1  — calmodulin-binding transcription activator 3-like isoform X1
  • Refseq:  XP_025793080.1  — calmodulin-binding transcription activator 2-like isoform X2
  • Swissprot:  Q8GSA7  — CMTA3_ARATH; Calmodulin-binding transcription activator 3
  • TrEMBL:  A0A1D6P7T4  — A0A1D6P7T4_MAIZE; Calmodulin-binding transcription activator 2
  • TrEMBL:  A0A2S3IQ52  — A0A2S3IQ52_9POAL; Uncharacterized protein
  • TrEMBL:  A0A2S3IQ72  — A0A2S3IQ72_9POAL; Uncharacterized protein
  • TrEMBL:  I1QWU0  — I1QWU0_ORYGL; Uncharacterized protein
  • STRING:  Pavir.Ia03131.1.p  — (Panicum virgatum)
  • STRING:  ORGLA10G0167300.1  — (Oryza glaberrima)

Gene Ontology:

  • GO:0005634  — Cellular Component — nucleus
  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • The CAMTA family of calmodulin binding transcription factors comprises six members in Arabidopsis (Bouche et al., 2002; Finkler et al., 2007). Each protein includes an IQ domain for calmodulin binding; ankyrin repeats for protein interactions; the TIG domain, which has nonspecific DNA binding activity; and the CG-1 domain, which has specific DNA binding activity. The CG-1 domain recognizes the core consensus sequence, vCGCGb, referred to as the CG-1 element (da Costa e Silva, 1994). This sequence matches the CM2 sequence, CCGCGT, and overlaps the ICEr1 element. Thus, the possibility was raised that one or more of the CAMTA proteins might have a role in regulating CBF2 expression.

Literature:

Sequences:

CDS Sequence:
  • >Zmw_sc02367.1.g00110.1|Zoysia_matrella|CAMTA|Zmw_sc02367.1.g00110.1
Protein Sequence:
  • >Zmw_sc02367.1.g00110.1|Zoysia_matrella|CAMTA|Zmw_sc02367.1.g00110.1
    MAEARKFVLPGQPPDFSQLQVEAQTRWLRPTEICEILFNYKLFSISPEPPNRPASGSLFLFDRKILRYFRKDGHNWRKKKDGKTIKEAHEKLK