Gene Details:

  • Gene ID: WALNUT_00007154-RA
  • Gene Family: CAMTA Family
  • Description: CAMTA Family protein
  • Species: Juglans regia
  • Source: CAMTA family gene from PlantTFDB

Protein Features:

Annotation Proteins:

Gene Ontology:

  • GO:0009408  — Biological Process — response to heat
  • GO:0009414  — Biological Process — response to water deprivation
  • GO:0009631  — Biological Process — cold acclimation
  • GO:0009816  — Biological Process — defense response to bacterium, incompatible interaction
  • GO:0045893  — Biological Process — positive regulation of transcription, DNA-templated
  • GO:0048578  — Biological Process — positive regulation of long-day photoperiodism, flowering
  • GO:0005634  — Cellular Component — nucleus
  • GO:0043565  — Molecular Function — sequence-specific DNA binding

Family Introduction:

  • The CAMTA family of calmodulin binding transcription factors comprises six members in Arabidopsis (Bouche et al., 2002; Finkler et al., 2007). Each protein includes an IQ domain for calmodulin binding; ankyrin repeats for protein interactions; the TIG domain, which has nonspecific DNA binding activity; and the CG-1 domain, which has specific DNA binding activity. The CG-1 domain recognizes the core consensus sequence, vCGCGb, referred to as the CG-1 element (da Costa e Silva, 1994). This sequence matches the CM2 sequence, CCGCGT, and overlaps the ICEr1 element. Thus, the possibility was raised that one or more of the CAMTA proteins might have a role in regulating CBF2 expression.

Literature:

Sequences:

CDS Sequence:
  • >WALNUT_00007154-RA|Juglans_regia|CAMTA|WALNUT_00007154-RA
    ATGCAGAAGGGTTCGAAGAGCAAGTGTGAGTCTGCATTGCACCAGCTCTTGAAGGAGAGGGCTAAGAACCAGGTCAACAACCTTGAAGGGGTGCTCAACAACCTCCAATCTACAAGGAAGGAGAGCCGAGCTTATGACATTGTGGTTTTAGAGCAACAAGTACATCAGAGGTTGCGAGAGTGGAAATCTAAGCTCAATGAGCCATCCATGATTTCTTCTTTAGTTACGTGTAGTTTCAATTCAGAGGAGTTCGCACATTTTTTGCGACTTTGTGAAGAAGAAGATGATGCAATTACGTATGGCAGTAAGAGCAATGCACTCAACTTGTTCGATAAAATACGCAGGCAAGGTCCTTGTTTTGGCATGTTGAAAGTCGAAGATGGGAAAACATTGAAGGAAGCTCATGAGAAGCTGAAGGTTGGTTGTTTTGATGTGCTACGCTGCTACTACACTCATGGGGAAGAGGTCTTGGAAAACTCCAGAGGATTCCATACCCCTATAACTTCTCGTGCATCATCTGAACCTTAA
Protein Sequence:
  • >WALNUT_00007154-RA|Juglans_regia|CAMTA|WALNUT_00007154-RA
    MQKGSKSKCESALHQLLKERAKNQVNNLEGVLNNLQSTRKESRAYDIVVLEQQVHQRLREWKSKLNEPSMISSLVTCSFNSEEFAHFLRLCEEEDDAITYGSKSNALNLFDKIRRQGPCFGMLKVEDGKTLKEAHEKLKVGCFDVLRCYYTHGEEVLENSRGFHTPITSRASSEP