Gene Details:

  • Gene ID: Lj4g3v2573590.2
  • Gene Family: CAMTA Family
  • Description: CAMTA Family protein
  • Species: Lotus japonicus
  • Source: CAMTA family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_004504403.1  — calmodulin-binding transcription activator 4 isoform X1
  • Refseq:  XP_004504404.1  — calmodulin-binding transcription activator 4 isoform X3
  • Refseq:  XP_004504405.1  — calmodulin-binding transcription activator 4 isoform X4
  • Refseq:  XP_012572321.1  — calmodulin-binding transcription activator 4 isoform X2
  • Refseq:  XP_012572322.1  — calmodulin-binding transcription activator 4 isoform X5
  • Swissprot:  Q9FYG2  — CMTA4_ARATH; Calmodulin-binding transcription activator 4
  • TrEMBL:  A0A1S2YGC3  — A0A1S2YGC3_CICAR; calmodulin-binding transcription activator 4 isoform X1
  • TrEMBL:  A0A1S2YGD5  — A0A1S2YGD5_CICAR; calmodulin-binding transcription activator 4 isoform X4
  • TrEMBL:  A0A1S2YHB3  — A0A1S2YHB3_CICAR; calmodulin-binding transcription activator 4 isoform X3
  • TrEMBL:  A0A1S3E925  — A0A1S3E925_CICAR; calmodulin-binding transcription activator 4 isoform X5
  • TrEMBL:  A0A1S3EBH0  — A0A1S3EBH0_CICAR; calmodulin-binding transcription activator 4 isoform X2
  • STRING:  XP_004504403.1  — (Cicer arietinum)
  • STRING:  AET04958  — (Medicago truncatula)

Gene Ontology:

  • GO:0005634  — Cellular Component — nucleus
  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • The CAMTA family of calmodulin binding transcription factors comprises six members in Arabidopsis (Bouche et al., 2002; Finkler et al., 2007). Each protein includes an IQ domain for calmodulin binding; ankyrin repeats for protein interactions; the TIG domain, which has nonspecific DNA binding activity; and the CG-1 domain, which has specific DNA binding activity. The CG-1 domain recognizes the core consensus sequence, vCGCGb, referred to as the CG-1 element (da Costa e Silva, 1994). This sequence matches the CM2 sequence, CCGCGT, and overlaps the ICEr1 element. Thus, the possibility was raised that one or more of the CAMTA proteins might have a role in regulating CBF2 expression.

Literature:

Sequences:

CDS Sequence:
  • >Lj4g3v2573590.2|Lotus_japonicus|CAMTA|Lj4g3v2573590.2
    ATGACACCTGGTCACGAATATGATATTAATGATCTGTATCAAGAAGCTCAAAGGAGATGGCTGAAGCCTGCAGAGGTGATGTGCATTTTACAGAATCATGAAAAGTACCAGTTCTCTCAAGAGCCTCCGCAAAAGCCATCCAGTGGATCACTGTTTCTGTTTAACAGAAGAGTCCTGCGTTTCTTCCGCAGAGATGGTCATGCCTGGCGGAAGAAAAGAGATGGAAGAGCT
Protein Sequence:
  • >Lj4g3v2573590.2|Lotus_japonicus|CAMTA|Lj4g3v2573590.2
    MTPGHEYDINDLYQEAQRRWLKPAEVMCILQNHEKYQFSQEPPQKPSSGSLFLFNRRVLRFFRRDGHAWRKKRDGRA