Gene Details:

  • Gene ID: KZV44852.1
  • Gene Family: CAMTA Family
  • Description: CAMTA Family protein
  • Species: Dorcoceras hygrometricum
  • Source: CAMTA family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_003547365.1  — calmodulin-binding transcription activator 5
  • Refseq:  XP_008223308.1  — PREDICTED: calmodulin-binding transcription activator 5-like isoform X1
  • Refseq:  XP_022874687.1  — calmodulin-binding transcription activator 5-like isoform X1
  • Refseq:  XP_022874688.1  — calmodulin-binding transcription activator 5-like isoform X1
  • Refseq:  XP_022874689.1  — calmodulin-binding transcription activator 5-like isoform X2
  • Refseq:  XP_028204125.1  — calmodulin-binding transcription activator 5-like
  • Swissprot:  O23463  — CMTA5_ARATH; Calmodulin-binding transcription activator 5
  • TrEMBL:  A0A2Z7CCV0  — A0A2Z7CCV0_9LAMI; Calmodulin-binding transcription activator 5-like (Fragment)
  • STRING:  Lus10041126  — (Linum usitatissimum)

Gene Ontology:

  • GO:0005634  — Cellular Component — nucleus
  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • The CAMTA family of calmodulin binding transcription factors comprises six members in Arabidopsis (Bouche et al., 2002; Finkler et al., 2007). Each protein includes an IQ domain for calmodulin binding; ankyrin repeats for protein interactions; the TIG domain, which has nonspecific DNA binding activity; and the CG-1 domain, which has specific DNA binding activity. The CG-1 domain recognizes the core consensus sequence, vCGCGb, referred to as the CG-1 element (da Costa e Silva, 1994). This sequence matches the CM2 sequence, CCGCGT, and overlaps the ICEr1 element. Thus, the possibility was raised that one or more of the CAMTA proteins might have a role in regulating CBF2 expression.

Literature:

Sequences:

CDS Sequence:
  • >KZV44852.1|Dorcoceras_hygrometricum|CAMTA|KZV44852.1
    TTGATAGATTTGGACGTAGGCGCCATCATGGTGGAGGCGAAGGCAAGGTGGCTCAGGCCGAATGAGATTCATGCTATTCTTTGCAACTTCAAATATTTCACTGTGAATGTCAAACCTGTGAATCTGCCGAAAAGTGGCACCATTGTGTTATTTGATCGTAAGATGTTCCGGAATTTTCGGAAAGATGGCTATAAGTGGAAGAAGAAAAAGGATGGAAAAACTGTTAAAGAAGCCCATGAACACTTAAAAGTTGGTAATGAGGAAAGAATTCATGTATACTATGCACATGGAGAAGATAGCCCAACTTTTGTTCGCAGATGTTACTGGCTACTGGACAAGTATGAAAACACCAATACATTTTGCTAG
Protein Sequence:
  • >KZV44852.1|Dorcoceras_hygrometricum|CAMTA|KZV44852.1
    LIDLDVGAIMVEAKARWLRPNEIHAILCNFKYFTVNVKPVNLPKSGTIVLFDRKMFRNFRKDGYKWKKKKDGKTVKEAHEHLKVGNEERIHVYYAHGEDSPTFVRRCYWLLDKYENTNTFC