Gene Details:
- Gene ID: KZV44852.1
- Gene Family: CAMTA Family
- Description: CAMTA Family protein
- Species: Dorcoceras hygrometricum
- Source: CAMTA family gene from PlantTFDB
Protein Features:
- Pfam: PF02458
- Gene3D: G3DSA:3.30.559.10
- PROSITE profile: PS51437
- SMART: SM01076
- Pfam: PF03859
- Gene3D: G3DSA:2.60.40.10
- Pfam: PF01833
- SuperFamily: SSF81296
- Gene3D: G3DSA:1.25.40.20
- PROSITE profile: PS50297
- SuperFamily: SSF48403
- Pfam: PF12796
- SMART: SM00248
- PROSITE profile: PS50088
- SuperFamily: SSF52540
- SMART: SM00015
- PROSITE profile: PS50096
- Pfam: PF00612
- InterPro: IPR003480 IPR023213 IPR005559 IPR013783 IPR002909 IPR014756 IPR020683 IPR002110 IPR027417 IPR000048
Annotation Proteins:
- Refseq: XP_003547365.1 — calmodulin-binding transcription activator 5
- Refseq: XP_008223308.1 — PREDICTED: calmodulin-binding transcription activator 5-like isoform X1
- Refseq: XP_022874687.1 — calmodulin-binding transcription activator 5-like isoform X1
- Refseq: XP_022874688.1 — calmodulin-binding transcription activator 5-like isoform X1
- Refseq: XP_022874689.1 — calmodulin-binding transcription activator 5-like isoform X2
- Refseq: XP_028204125.1 — calmodulin-binding transcription activator 5-like
- Swissprot: O23463 — CMTA5_ARATH; Calmodulin-binding transcription activator 5
- TrEMBL: A0A2Z7CCV0 — A0A2Z7CCV0_9LAMI; Calmodulin-binding transcription activator 5-like (Fragment)
- STRING: Lus10041126 — (Linum usitatissimum)
Gene Ontology:
- GO:0005634 — Cellular Component — nucleus
- GO:0003677 — Molecular Function — DNA binding
Family Introduction:
- The CAMTA family of calmodulin binding transcription factors comprises six members in Arabidopsis (Bouche et al., 2002; Finkler et al., 2007). Each protein includes an IQ domain for calmodulin binding; ankyrin repeats for protein interactions; the TIG domain, which has nonspecific DNA binding activity; and the CG-1 domain, which has specific DNA binding activity. The CG-1 domain recognizes the core consensus sequence, vCGCGb, referred to as the CG-1 element (da Costa e Silva, 1994). This sequence matches the CM2 sequence, CCGCGT, and overlaps the ICEr1 element. Thus, the possibility was raised that one or more of the CAMTA proteins might have a role in regulating CBF2 expression.
Literature:
- CAMTAs: calmodulin-binding transcription activators from plants to human. DOI: 10.1016/j.febslet.2007.07.051 ; PMID: 17689537
Sequences:
CDS Sequence:
- >KZV44852.1|Dorcoceras_hygrometricum|CAMTA|KZV44852.1
TTGATAGATTTGGACGTAGGCGCCATCATGGTGGAGGCGAAGGCAAGGTGGCTCAGGCCGAATGAGATTCATGCTATTCTTTGCAACTTCAAATATTTCACTGTGAATGTCAAACCTGTGAATCTGCCGAAAAGTGGCACCATTGTGTTATTTGATCGTAAGATGTTCCGGAATTTTCGGAAAGATGGCTATAAGTGGAAGAAGAAAAAGGATGGAAAAACTGTTAAAGAAGCCCATGAACACTTAAAAGTTGGTAATGAGGAAAGAATTCATGTATACTATGCACATGGAGAAGATAGCCCAACTTTTGTTCGCAGATGTTACTGGCTACTGGACAAGTATGAAAACACCAATACATTTTGCTAG
Protein Sequence:
- >KZV44852.1|Dorcoceras_hygrometricum|CAMTA|KZV44852.1
LIDLDVGAIMVEAKARWLRPNEIHAILCNFKYFTVNVKPVNLPKSGTIVLFDRKMFRNFRKDGYKWKKKKDGKTVKEAHEHLKVGNEERIHVYYAHGEDSPTFVRRCYWLLDKYENTNTFC