Gene Details:

  • Gene ID: WALNUT_00025287-RA
  • Gene Family: C2H2 family
  • Description: C2H2 family protein
  • Species: Juglans regia
  • Source: C2H2 family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_018806524.1  — PREDICTED: zinc finger protein ZAT10-like
  • Swissprot:  Q96289  — ZAT10_ARATH; Zinc finger protein ZAT10
  • TrEMBL:  A0A2I4DHA0  — A0A2I4DHA0_JUGRE; zinc finger protein ZAT10-like
  • STRING:  POPTR_0002s12010.1  — (Populus trichocarpa)

Gene Ontology:

  • GO:0006979  — Biological Process — response to oxidative stress
  • GO:0009409  — Biological Process — response to cold
  • GO:0009414  — Biological Process — response to water deprivation
  • GO:0009611  — Biological Process — response to wounding
  • GO:0009644  — Biological Process — response to high light intensity
  • GO:0009651  — Biological Process — response to salt stress
  • GO:0009737  — Biological Process — response to abscisic acid
  • GO:0010117  — Biological Process — photoprotection
  • GO:0010200  — Biological Process — response to chitin
  • GO:0015979  — Biological Process — photosynthesis
  • GO:0035264  — Biological Process — multicellular organism growth
  • GO:0045892  — Biological Process — negative regulation of transcription, DNA-templated
  • GO:0005634  — Cellular Component — nucleus
  • GO:0043565  — Molecular Function — sequence-specific DNA binding
  • GO:0046872  — Molecular Function — metal ion binding

Family Introduction:

  • Numerous genes encoding the C2H2 zinc-finger domain have been characterized from a wide variety of eukaryotes, including plants. The canonical ZF (zinc finger) sequence (CX2-4CX3FX5LX2HX3-5H) contains two cysteines and two histidines that coordinate a zinc atom, creating a compact nucleic acid-binding domain. The majority of such proteins characterized to date are DNA-binding transcription factors, and many have been shown to play crucial roles in the development of plants, animals and fungi.

Literature:

Sequences:

CDS Sequence:
  • >WALNUT_00025287-RA|Juglans_regia|C2H2|WALNUT_00025287-RA
    ATGGCGTTGGAAGCTCTCAATTCTCCAAACACAGCCACCCCTTCGTTCCACTTCGAGGACGCCAAGCTCCATAATTTCCTTGAGCCATGGACAAAGCGCAAGCGTTCGAGGCGTGGACGGTTTGATAACCCACCCACAGAGGAAGAGTACCTCGCTCTTTGCCTTATCATGCTCGCTCGTGGGGGCGGCGGCGCAGCTACCACCACCTCGCAACATTACCTATCTCCTAGTCCTCCCGTGGCGCCCGAGGTGGCGACTACATCTGCCCCGAAGCTTGTTTATAAGTGCTCTGTTTGCAGCAAGGCATTCTCCTCTTACCAGGCACTTGGTGGACACAAGGCCAGCCACCGGAAACTCGCCGCTGCCGGTGGAGGCGAAGACTCTTCCACCTCCTCTGCCACCGCCACCGCTGCCGGGGCCAGCACCGTCACAGCCTCCAACAACGTCAGTGGTAAGGCTCACGAGTGCTCCATCTGCCACAAGTCCTTCCCCACGGGCCAGGCCTTGGGTGGACACAAGCGTTGTCACTACGAAGGAGGCAGCGGCGGCGTCGTAACCACTTCGGAAGGTGTGGGGTCCACTCACAGCCGCAGCCACAGCCACGACAACCAACACCATCGCAACTTCGACCTCAACCTCCCCGCTTTACCGGAGTTCTCGCTTAATTTCTTCATCCCAGGGGAAGACGAGGTGGAAAGCCCTCTGCCAGCGAAGAAGCCGCGCGTCTTGATGCCACCAAAACTCGAAGTTTCTCATTAG
Protein Sequence:
  • >WALNUT_00025287-RA|Juglans_regia|C2H2|WALNUT_00025287-RA
    MALEALNSPNTATPSFHFEDAKLHNFLEPWTKRKRSRRGRFDNPPTEEEYLALCLIMLARGGGGAATTTSQHYLSPSPPVAPEVATTSAPKLVYKCSVCSKAFSSYQALGGHKASHRKLAAAGGGEDSSTSSATATAAGASTVTASNNVSGKAHECSICHKSFPTGQALGGHKRCHYEGGSGGVVTTSEGVGSTHSRSHSHDNQHHRNFDLNLPALPEFSLNFFIPGEDEVESPLPAKKPRVLMPPKLEVSH