Gene Details:

  • Gene ID: Solyc06g053720.1.1
  • Gene Name: LOC101251096
  • Gene Family: C2H2 family
  • Description: C2H2 family protein
  • Species: Solanum lycopersicum
  • Source: C2H2 family gene from PlantTFDB

Protein Features:

Annotation Proteins:

Gene Ontology:

  • GO:0008361  — Biological Process — regulation of cell size
  • GO:0009755  — Biological Process — hormone-mediated signaling pathway
  • GO:0010093  — Biological Process — specification of floral organ identity
  • GO:0010160  — Biological Process — formation of organ boundary
  • GO:0042127  — Biological Process — regulation of cell proliferation
  • GO:0045892  — Biological Process — negative regulation of transcription, DNA-templated
  • GO:0005634  — Cellular Component — nucleus
  • GO:0003700  — Molecular Function — transcription factor activity, sequence-specific DNA binding
  • GO:0043565  — Molecular Function — sequence-specific DNA binding
  • GO:0044212  — Molecular Function — transcription regulatory region DNA binding
  • GO:0046872  — Molecular Function — metal ion binding

Family Introduction:

  • Numerous genes encoding the C2H2 zinc-finger domain have been characterized from a wide variety of eukaryotes, including plants. The canonical ZF (zinc finger) sequence (CX2-4CX3FX5LX2HX3-5H) contains two cysteines and two histidines that coordinate a zinc atom, creating a compact nucleic acid-binding domain. The majority of such proteins characterized to date are DNA-binding transcription factors, and many have been shown to play crucial roles in the development of plants, animals and fungi.

Literature:

Sequences:

CDS Sequence:
  • >Solyc06g053720.1.1|Solanum_lycopersicum|C2H2|Solyc06g053720.1.1
    ATGGAAAGACACATGAAAATGTTGAGTAAAAACAACAATGTTGAAGATTATGGAAATGAAGATGATGGGTTAATAATGTGTAGTTGGCCTCCAAGATGTTACACATGTAGTTTTTGTAAAAGGGGATTCAAATCAGCTCAAGCACTTGGTGGACATATGAATGTTCATAGAAGAGATAGGGCCAAGTTCCTCATGATGAGACACCACTCACCACCACCAACAACAAATGATAAACCTAGGTGTTCTCTTCTAAATCTCAAAACTAACCCTAACCCTAATATTCCACCGTCGTCAACGTCACCGCCGCCATCACCTTCTTCTTCAAGAAAACTCTCTCATTGTAGTCATGGTGGTGCTAATTCTCATGAAATCATGAGGAAATGTGTTGCAATTCCAAACTTGAAAAGTAGTACTACTACCAAAGACTCTTTATGCATGCGAGACAAAGAATTTGTGAGATTGGACTTGCAAATTGGCTTGTTTACTGAATCCAAGCAAGAATTGGATCTGGAACTTCGACTAGGATACACTTAG
Protein Sequence:
  • >Solyc06g053720.1.1|Solanum_lycopersicum|C2H2|Solyc06g053720.1.1
    MERHMKMLSKNNNVEDYGNEDDGLIMCSWPPRCYTCSFCKRGFKSAQALGGHMNVHRRDRAKFLMMRHHSPPPTTNDKPRCSLLNLKTNPNPNIPPSSTSPPPSPSSSRKLSHCSHGGANSHEIMRKCVAIPNLKSSTTTKDSLCMRDKEFVRLDLQIGLFTESKQELDLELRLGYT*