Gene Details:
- Gene ID: Niben101Scf06091g01010.1
- Gene Family: C2H2 family
- Description: C2H2 family protein
- Species: Nicotiana benthamiana
- Source: C2H2 family gene from PlantTFDB
Protein Features:
- Pfam: PF10248
- SuperFamily: SSF103025
- TIGRFAMs: TIGR03317
- Gene3D: G3DSA:3.40.50.1010
- SuperFamily: SSF57667
- PROSITE profile: PS50157
- Gene3D: G3DSA:3.30.160.60
- PROSITE pattern: PS00028
- Pfam: PF01936
- InterPro: IPR019376 IPR017703 IPR029060 IPR007087 IPR013087 IPR021139
Annotation Proteins:
- Refseq: XP_016464755.1 — PREDICTED: zinc finger protein 3-like
- TrEMBL: A0A1S3ZJR7 — A0A1S3ZJR7_TOBAC; zinc finger protein 3-like
- STRING: XP_009623268.1 — (Nicotiana tomentosiformis)
Gene Ontology:
- GO:0046872 — Molecular Function — metal ion binding
Family Introduction:
- Numerous genes encoding the C2H2 zinc-finger domain have been characterized from a wide variety of eukaryotes, including plants. The canonical ZF (zinc finger) sequence (CX2-4CX3FX5LX2HX3-5H) contains two cysteines and two histidines that coordinate a zinc atom, creating a compact nucleic acid-binding domain. The majority of such proteins characterized to date are DNA-binding transcription factors, and many have been shown to play crucial roles in the development of plants, animals and fungi.
Literature:
- AtZFP1, encoding Arabidopsis thaliana C2H2 zinc-finger protein 1, is expressed downstream of photomorphogenic activation. DOI: 10.1023/a:1006352809700 ; PMID: 10794528
Sequences:
CDS Sequence:
- >Niben101Scf06091g01010.1|Nicotiana_benthamiana|C2H2|Niben101Scf06091g01010.1
Protein Sequence:
- >Niben101Scf06091g01010.1|Nicotiana_benthamiana|C2H2|Niben101Scf06091g01010.1
MKFPTSDNSCTSLKVEAPFLSPTTVLSNYQNKWLSKQKMESQTTEEMSQIQTTDEQENNDLILDLSLCNTDHGSKSNLQTSSSSDLNSRGNNNTNETEPRVFSCNYCQRKFYSSQALGGHQNAHKRERTMAKRGQKISSTATNFGYDKYSSMVSLPLHGSFNGSLGIQVHSMIHKPSSTPFGAPLYGHPGWSIRRPIDQQPAIGRLAPPDCYSNTTYNGGTSSGGGAARFDNNIQKFPTVVDGISAYRWDSGGGPHVSKSNNQEELKKLDLSLKL