Gene Details:

Protein Features:

Annotation Proteins:

  • Refseq:  XP_009804392.1  — PREDICTED: Krueppel-related zinc finger protein 1-like isoform X2
  • Refseq:  XP_016477869.1  — PREDICTED: transcription factor IIIA-like isoform X2
  • Swissprot:  Q84MZ4  — TF3A_ARATH; Transcription factor IIIA
  • TrEMBL:  A0A1S4AMJ8  — A0A1S4AMJ8_TOBAC; transcription factor IIIA-like isoform X2
  • TrEMBL:  A0A1U7YJY4  — A0A1U7YJY4_NICSY; Krueppel-related zinc finger protein 1-like isoform X2
  • STRING:  XP_009804391.1  — (Nicotiana sylvestris)

Gene Ontology:

  • GO:0005730  — Cellular Component — nucleolus
  • GO:0003700  — Molecular Function — transcription factor activity, sequence-specific DNA binding
  • GO:0008097  — Molecular Function — 5S rRNA binding
  • GO:0046872  — Molecular Function — metal ion binding
  • GO:0080084  — Molecular Function — 5S rDNA binding

Family Introduction:

  • Numerous genes encoding the C2H2 zinc-finger domain have been characterized from a wide variety of eukaryotes, including plants. The canonical ZF (zinc finger) sequence (CX2-4CX3FX5LX2HX3-5H) contains two cysteines and two histidines that coordinate a zinc atom, creating a compact nucleic acid-binding domain. The majority of such proteins characterized to date are DNA-binding transcription factors, and many have been shown to play crucial roles in the development of plants, animals and fungi.

Literature:

Sequences:

CDS Sequence:
  • >Niben101Scf04267g00014.1|Nicotiana_benthamiana|C2H2|Niben101Scf04267g00014.1
Protein Sequence:
  • >Niben101Scf04267g00014.1|Nicotiana_benthamiana|C2H2|Niben101Scf04267g00014.1
    MAVKVLGEMGEEKKEVIFRDIRRYYCEFCGICRSKKSLISSHILSNHHDEMERRKDEVNEDVKKKKGPKMNICEECGVSFQKPAHLKQHMQSHSLERPFVCHIDDCQSNYRRKDHLMRHLLQHQGKLFECPVDSCKCAFSIQGNMTRHVKEMHDQCASPEANLPKHYVCSEPRCGKVFKFASKLKKHEDSHGKSNFKILIIFKLETMEALCLEPGCMKHFTNEKCLKEHIESCHQHIVCEICGTKQLKKNIKRHLRTHEEESTSERIKCEFQDCQHTFSTKSNLIQHVKAVHLGDKPFSCGVAGCGMKFAFKHVRDRHEKSGCHVYTPGDFVEADEQFRSRPRGGRKRKLPVFEAVMRKRIKPPCDTDPMFYQGSEYLSWLLSAESDEEL