Gene Details:

Protein Features:

Annotation Proteins:

  • Refseq:  XP_019236543.1  — PREDICTED: zinc finger protein WIP6-like
  • Swissprot:  Q9FX68  — ZWIP6_ARATH; Zinc finger protein WIP6
  • TrEMBL:  A0A1S3X8B9  — A0A1S3X8B9_TOBAC; zinc finger protein WIP6-like
  • TrEMBL:  A0A1U7Y132  — A0A1U7Y132_NICSY; protein TRANSPARENT TESTA 1
  • STRING:  XP_009796838.1  — (Nicotiana sylvestris)

Gene Ontology:

  • GO:0010087  — Biological Process — phloem or xylem histogenesis
  • GO:0010305  — Biological Process — leaf vascular tissue pattern formation
  • GO:0010588  — Biological Process — cotyledon vascular tissue pattern formation
  • GO:0048364  — Biological Process — root development
  • GO:0005634  — Cellular Component — nucleus
  • GO:0003676  — Molecular Function — nucleic acid binding
  • GO:0046872  — Molecular Function — metal ion binding

Family Introduction:

  • Numerous genes encoding the C2H2 zinc-finger domain have been characterized from a wide variety of eukaryotes, including plants. The canonical ZF (zinc finger) sequence (CX2-4CX3FX5LX2HX3-5H) contains two cysteines and two histidines that coordinate a zinc atom, creating a compact nucleic acid-binding domain. The majority of such proteins characterized to date are DNA-binding transcription factors, and many have been shown to play crucial roles in the development of plants, animals and fungi.

Literature:

Sequences:

CDS Sequence:
  • >Niben101Scf03150g05001.1|Nicotiana_benthamiana|C2H2|Niben101Scf03150g05001.1
Protein Sequence:
  • >Niben101Scf03150g05001.1|Nicotiana_benthamiana|C2H2|Niben101Scf03150g05001.1
    MQTHSITYLSSSESGCLETEVEDELSTVLSLGPPGQKNTTKFHFQSYYNQYSSYGEGVTAALHTDSSGTSSNNNNPSKNKGGDIVSVANNGQYWIPTPAQILVGPTQFSCAVCNKTFNRFNNMQMHMWGHGSQYRKGPDSLKGTKPASSMLRFPCYCCAEGCKNNIEHPRSKPLKDFRTLQTHYKRKHGAKPFTCRKCGKNFAVRGDWRTHEKNCGKLWFCICGSDFKHKRSLKDHVRAFGDGHAPHKGNLDDELYGNGT