Gene Details:

Protein Features:

Annotation Proteins:

  • Refseq:  XP_019245243.1  — PREDICTED: protein TRANSPARENT TESTA 1-like
  • Swissprot:  Q8VWG3  — TT1_ARATH; Protein TRANSPARENT TESTA 1
  • TrEMBL:  A0A1J6IGH3  — A0A1J6IGH3_NICAT; Protein transparent testa 1
  • STRING:  XP_009761488.1  — (Nicotiana sylvestris)

Family Introduction:

  • Numerous genes encoding the C2H2 zinc-finger domain have been characterized from a wide variety of eukaryotes, including plants. The canonical ZF (zinc finger) sequence (CX2-4CX3FX5LX2HX3-5H) contains two cysteines and two histidines that coordinate a zinc atom, creating a compact nucleic acid-binding domain. The majority of such proteins characterized to date are DNA-binding transcription factors, and many have been shown to play crucial roles in the development of plants, animals and fungi.

Literature:

Sequences:

CDS Sequence:
  • >Niben101Scf02537g10009.1|Nicotiana_benthamiana|C2H2|Niben101Scf02537g10009.1
Protein Sequence:
  • >Niben101Scf02537g10009.1|Nicotiana_benthamiana|C2H2|Niben101Scf02537g10009.1
    MERLYLASSSSVENQIEPFDFFAEKTQNAFEFLSLSQSSEKEITLSNNQDNPNSCNWLDKEDDVTVALHIGLPNFNNTSTNISTHHNKGDANIAATNYWIPTPSQILVGFTQFSCHICHKTFNRYNNLQQMHMWGHGSQYRKGPESLKGTQPRAMLGIPCYCCEEGCKNNINHPRAKPLKDFRTLQTHYKRKHGTKRFACRKCGKCLAVKGDWRTHEKNCGKRWLCICGSDFKHKRSLKDHIASFGESHGPCPPNSFEGVEAQKKYSVFV