Gene Details:

Protein Features:

Annotation Proteins:

  • Refseq:  XP_019233291.1  — PREDICTED: zinc finger protein 6-like
  • Swissprot:  Q9C9H1  — GIS3_ARATH; Zinc finger protein GIS3
  • TrEMBL:  A0A1J6KFI6  — A0A1J6KFI6_NICAT; Zinc finger protein 6
  • STRING:  XP_009621926.1  — (Nicotiana tomentosiformis)

Gene Ontology:

  • GO:0003676  — Molecular Function — nucleic acid binding
  • GO:0046872  — Molecular Function — metal ion binding

Family Introduction:

  • Numerous genes encoding the C2H2 zinc-finger domain have been characterized from a wide variety of eukaryotes, including plants. The canonical ZF (zinc finger) sequence (CX2-4CX3FX5LX2HX3-5H) contains two cysteines and two histidines that coordinate a zinc atom, creating a compact nucleic acid-binding domain. The majority of such proteins characterized to date are DNA-binding transcription factors, and many have been shown to play crucial roles in the development of plants, animals and fungi.

Literature:

Sequences:

CDS Sequence:
  • >Niben101Scf00307g04007.1|Nicotiana_benthamiana|C2H2|Niben101Scf00307g04007.1
Protein Sequence:
  • >Niben101Scf00307g04007.1|Nicotiana_benthamiana|C2H2|Niben101Scf00307g04007.1
    MAELEFQSKHGTYNPTSNRSLKLFGFNMTEEDQEQEVDSTTKTSSGSSASGSFPASDGRKYECQYCNREFANSQALGGHQNAHKKERQQLKRAQMQASRNAYMRNPIVSAFALPSHLLPPPGHMVVPASSPSWVYVPRAAPLFHGCVFPTSNSVRGVGNFQYTGVVAESSLESVGPQHVKAHSGRVNNFCTVTKHLKK