Gene Details:

  • Gene ID: MELO3C016567P1
  • Gene Family: C2H2 family
  • Description: C2H2 family protein
  • Species: Cucumis melo
  • Source: C2H2 family gene from PlantTFDB

Protein Features:

Gene Ontology:

  • GO:0046872  — Molecular Function — metal ion binding

Family Introduction:

  • Numerous genes encoding the C2H2 zinc-finger domain have been characterized from a wide variety of eukaryotes, including plants. The canonical ZF (zinc finger) sequence (CX2-4CX3FX5LX2HX3-5H) contains two cysteines and two histidines that coordinate a zinc atom, creating a compact nucleic acid-binding domain. The majority of such proteins characterized to date are DNA-binding transcription factors, and many have been shown to play crucial roles in the development of plants, animals and fungi.

Literature:

Sequences:

CDS Sequence:
  • >MELO3C016567P1|Cucumis_melo|C2H2|MELO3C016567P1
    ATGTCAAGCAAACAAGCCATGTCAAGCAAACAAGCTACGTCAAGCACACAAGCTACGTCAAGCACACAAGCTACGTCAAGCACACCACAGTTTCCTTGCACCTTGTGTGACAAGGTTTACGAGAGCAAGAAGCGGCTGGTTGACCATCAGAACGACCGCCACAGGGGAAAGACTCATACTTGTCCGACATGTTCGAGTCCAAAACCGATCTAA
Protein Sequence:
  • >MELO3C016567P1|Cucumis_melo|C2H2|MELO3C016567P1
    MSSKQAMSSKQATSSTQATSSTQATSSTPQFPCTLCDKVYESKKRLVDHQNDRHRGKTHTCPTCSSPKPI*