Gene Details:

Protein Features:

Annotation Proteins:

  • Refseq:  NP_001105491.1  — maize Em binding protein-1a
  • Swissprot:  P25032  — EMBP1_WHEAT; DNA-binding protein EMBP-1
  • TrEMBL:  A0A446KYA0  — A0A446KYA0_TRITD; Uncharacterized protein
  • TrEMBL:  A0A446KYA6  — A0A446KYA6_TRITD; Uncharacterized protein
  • STRING:  Traes_2BL_245DDBC7B.2  — (Triticum aestivum)

Family Introduction:

  • The bZIP domain consists of two structural features located on a contiguous alpha-helix: first, a basic region of ~ 16 amino acid residues containing a nuclear localization signal followed by an invariant N-x7-R/K motif that contacts the DNA; and, second, a heptad repeat of leucines or other bulky hydrophobic amino acids positioned exactly nine amino acids towards the C-terminus, creating an amphipathic helix. To bind DNA, two subunits adhere via interactions between the hydrophobic sides of their helices, which creates a superimposing coiled-coil structure. The ability to form homo- and heterodimers is influenced by the electrostatic attraction and repulsion of polar residues flanking the hydrophobic interaction surface of the helices.
  • Plant bZIP proteins preferentially bind to DNA sequences with an ACGT core. Binding specificity is regulated by flanking nucleotides. Plant bZIPs preferentially bind to the A-box (TACGTA), C-box (GACGTC) and G-box (CACGTG), but there are also examples of nonpalindromic binding sites.

Literature:

Sequences:

CDS Sequence:
  • >Zpz_sc01643.1.g00050.1.sm.mkhc|Zoysia_pacifica|bZIP|Zpz_sc01643.1.g00050.1.sm.mkhc
Protein Sequence:
  • >Zpz_sc01643.1.g00050.1.sm.mkhc|Zoysia_pacifica|bZIP|Zpz_sc01643.1.g00050.1.sm.mkhc
    MPSSSDEQPKPPEPPAAVVPAAVTAAPQTHAEWAASMQAYYAAAGHPYAWPAQHLMAAAAAGATYGAPVPFPVYHPGAAAAYYAHASMAAGVPYPTPEAAAAAAVAAEGKGKGKGGGASSEKGNSGEDASRSGDSGSEESSDTRDDDTDHKDSSAPKKRKSGNTSGEGEPSHPAVVHYPAVESPFPVKGRSASKLPVSAPGRAALPNATPNLNIGMDLWTASPALAVPAVQGEANPGLALARRDGAAPLQECEELGKKVAELTTENNILRAELANLKKACQDMETENARLMLTAGPL