Gene Details:
- Gene ID: Zmw_sc02324.1.g00210.1
- Gene Family: bZIP Family
- Description: bZIP Family protein
- Species: Zoysia matrella
- Source: bZIP family gene from PlantTFDB
Protein Features:
- SMART: SM00338
- Gene3D: G3DSA:1.20.5.170
- PROSITE profile: PS50217
- Pfam: PF00170
- SuperFamily: SSF57959
- PROSITE pattern: PS00036
- InterPro: IPR004827
Annotation Proteins:
- Refseq: NP_001346403.1 — uncharacterized protein LOC100216655
- Refseq: XP_008664944.1 — uncharacterized protein LOC100216655 isoform X1
- Refseq: XP_008664950.1 — uncharacterized protein LOC100216655 isoform X2
- TrEMBL: A0A1D6JVJ2 — A0A1D6JVJ2_MAIZE; BZIP transcription factor 16
- TrEMBL: A0A1D6JVJ4 — A0A1D6JVJ4_MAIZE; BZIP transcription factor 16
- TrEMBL: C0PE09 — C0PE09_MAIZE; BZIP transcription factor 16
- TrEMBL: K4JC67 — K4JC67_MAIZE; BZIP-type transcription factor (Fragment)
- STRING: GRMZM2G157177_P01 — (Zea mays)
Family Introduction:
- The bZIP domain consists of two structural features located on a contiguous alpha-helix: first, a basic region of ~ 16 amino acid residues containing a nuclear localization signal followed by an invariant N-x7-R/K motif that contacts the DNA; and, second, a heptad repeat of leucines or other bulky hydrophobic amino acids positioned exactly nine amino acids towards the C-terminus, creating an amphipathic helix. To bind DNA, two subunits adhere via interactions between the hydrophobic sides of their helices, which creates a superimposing coiled-coil structure. The ability to form homo- and heterodimers is influenced by the electrostatic attraction and repulsion of polar residues flanking the hydrophobic interaction surface of the helices.
- Plant bZIP proteins preferentially bind to DNA sequences with an ACGT core. Binding specificity is regulated by flanking nucleotides. Plant bZIPs preferentially bind to the A-box (TACGTA), C-box (GACGTC) and G-box (CACGTG), but there are also examples of nonpalindromic binding sites.
Literature:
Sequences:
CDS Sequence:
- >Zmw_sc02324.1.g00210.1|Zoysia_matrella|bZIP|Zmw_sc02324.1.g00210.1
Protein Sequence:
- >Zmw_sc02324.1.g00210.1|Zoysia_matrella|bZIP|Zmw_sc02324.1.g00210.1
MAGPGTAVNMSGDYWGAPTSAEWEEVANRADLLKQENSSLKEELKQLQEKCDILTSENTSLHEKLKELEDEKSNGNWYKD