Information report for XP_010108652.1
Gene Details
|
|
Functional Annotation
- Refseq: XP_010108652.1 — transcription factor VIP1
- Swissprot: Q9MA75 — VIP1_ARATH; Transcription factor VIP1
- TrEMBL: W9S077 — W9S077_9ROSA; Transcription factor VIP1
- STRING: XP_010108652.1 — (Morus notabilis)
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0007231 — Biological Process — osmosensory signaling pathway
- GO:0008272 — Biological Process — sulfate transport
- GO:0009294 — Biological Process — DNA mediated transformation
- GO:0009652 — Biological Process — thigmotropism
- GO:0009970 — Biological Process — cellular response to sulfate starvation
- GO:0045596 — Biological Process — negative regulation of cell differentiation
- GO:0051170 — Biological Process — nuclear import
- GO:0005634 — Cellular Component — nucleus
- GO:0005829 — Cellular Component — cytosol
- GO:0003682 — Molecular Function — chromatin binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
- GO:0043565 — Molecular Function — sequence-specific DNA binding
- GO:0043621 — Molecular Function — protein self-association
- GO:0051019 — Molecular Function — mitogen-activated protein kinase binding
Family Introduction
- The bZIP domain consists of two structural features located on a contiguous alpha-helix: first, a basic region of ~ 16 amino acid residues containing a nuclear localization signal followed by an invariant N-x7-R/K motif that contacts the DNA; and, second, a heptad repeat of leucines or other bulky hydrophobic amino acids positioned exactly nine amino acids towards the C-terminus, creating an amphipathic helix. To bind DNA, two subunits adhere via interactions between the hydrophobic sides of their helices, which creates a superimposing coiled-coil structure. The ability to form homo- and heterodimers is influenced by the electrostatic attraction and repulsion of polar residues flanking the hydrophobic interaction surface of the helices.
- Plant bZIP proteins preferentially bind to DNA sequences with an ACGT core. Binding specificity is regulated by flanking nucleotides. Plant bZIPs preferentially bind to the A-box (TACGTA), C-box (GACGTC) and G-box (CACGTG), but there are also examples of nonpalindromic binding sites.
Literature and News
Gene Resources
Homologs
- Citrullus lanatus: Cla013824
- Citrus sinensis: orange1.1g019163m
- Cucumis melo: MELO3C008356P1
- Cucumis sativus: Cucsa.363640.1, Cucsa.079030.1
- Fragaria vesca: mrna32629.1-v1.0-hybrid
- Gossypium arboreum: Cotton_A_10378_BGI-A2_v1.0
- Gossypium hirsutum: Gh_A02G0665, Gh_D02G0710
- Juglans regia: WALNUT_00012594-RA
- Malus domestica: MDP0000602946
- Manihot esculenta: Manes.18G090600.1.p, Manes.02G178100.1.p
- Populus trichocarpa: Potri.002G069500.1
- Prunus mume: XP_008243636.1
- Prunus persica: Prupe.8G026300.1.p
- Pyrus bretschneideri: Pbr010517.1, Pbr036339.1
- Ziziphus jujuba: XP_015865794.1
Sequences
CDS Sequence:
- >XP_010108652.1|Morus_notabilis|bZIP|XP_010108652.1
ATGGAGTCAAAGCCACGGCCGCCGGGGGCAACGGACATGGCGATCGACCAGATGCCGGAGACGCCGAAGCGTGGTTCCCACCACCGTAGGGCCCACTCGGACACCTCGTTCCGTTTCCCGAACCTCGACGACCTCCTCCTCTTCGACGCCTCCGACCTCGACCTGACCTCCCTTCCTTCACCATCGCCTTCCCCTTCTCCGGTGGGCCTCGATCACCCTTCCAAGTCCTCCTCCGACGAGTTTTCCGGCCCAACAACAAGGCCCAGCACCACCAGACCCAGCGCCTCTTCCGGCGCTCCGGCCCATATCCGGAGCCTGTCGGTGGACTCGGACTTCTTCGACGGCTTGGGTTTTGGCGGCGGAGAGACGGCGGCGAAGGAGGCTGTTGGAGAGAAGAGGGGAGGGCGTCACGGCCATAGTAACTCAGTTGATGGGTTCTGTACGGCGTCGTTTGAGGTTGATTCTGTTGGTGGTCTTCTTGGGGTTGATGCTGTTAAGAAGGCTATGGCTCCTGATAGGCTCGCCGAGCTTGCTCTTATTGACCCCAAACGAGCTAAAAGGATTCTTGCTAACAGACAATCTGCTGCGAGGTCGAAGGAGAGGAAGATACGTTATACCAATGAATTGGAGAGGAAGGTACAGACACTTCAAACCGAAGCAACCACCCTTTCTGCGCAGGTCACACTGTTACAGAGAGACACTACTGGGTTAACTTCTGAGAATAAGGAGCTCAAACTTCGGTTACAGGCTATGGAACAACAAGCAGAACTTAGAGAAGCTCTGAATGAAAAATTGAAGGAAGAAGTTCAGCGGCTTAAGATCGCAACCGGTCAAATGCCGCACGTCAATGGCAATCCATTCAACAGAGGACTGCCTCCTCAATTCGCGTCCCAACAGCCAGTCCTCCACCACTTTGGTAGCCACCAGAGTCAGCAGCAACAGCAGCTTCACATGCCTCAGTCATCAAGCAATAATGGGCAGCCTCACCTGGGCTTCTTGGACTTCAACCAAAGGGTCTAG
Protein Sequence:
- >XP_010108652.1|Morus_notabilis|bZIP|XP_010108652.1
MESKPRPPGATDMAIDQMPETPKRGSHHRRAHSDTSFRFPNLDDLLLFDASDLDLTSLPSPSPSPSPVGLDHPSKSSSDEFSGPTTRPSTTRPSASSGAPAHIRSLSVDSDFFDGLGFGGGETAAKEAVGEKRGGRHGHSNSVDGFCTASFEVDSVGGLLGVDAVKKAMAPDRLAELALIDPKRAKRILANRQSAARSKERKIRYTNELERKVQTLQTEATTLSAQVTLLQRDTTGLTSENKELKLRLQAMEQQAELREALNEKLKEEVQRLKIATGQMPHVNGNPFNRGLPPQFASQQPVLHHFGSHQSQQQQQLHMPQSSSNNGQPHLGFLDFNQRV