Gene Details:
- Gene ID: Vradi0095s00150.1
- Gene Family: bZIP Family
- Description: bZIP Family protein
- Species: Vigna radiata
- Source: bZIP family gene from PlantTFDB
Protein Features:
- SMART: SM00338
- Gene3D: G3DSA:1.20.5.170
- PROSITE profile: PS50217
- Pfam: PF00170
- SuperFamily: SSF57959
- PROSITE pattern: PS00036
- InterPro: IPR004827
Annotation Proteins:
- Refseq: XP_014490287.1 — cellulose synthase A catalytic subunit 1 [UDP-forming]
- TrEMBL: A0A1S3T941 — A0A1S3T941_VIGRR; cellulose synthase A catalytic subunit 1 [UDP-forming]
- STRING: XP_007146305.1 — (Phaseolus vulgaris)
Gene Ontology:
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0009737 — Biological Process — response to abscisic acid
- GO:0009740 — Biological Process — gibberellic acid mediated signaling pathway
- GO:0010017 — Biological Process — red or far-red light signaling pathway
- GO:0010099 — Biological Process — regulation of photomorphogenesis
- GO:0010114 — Biological Process — response to red light
- GO:0010218 — Biological Process — response to far red light
- GO:0010224 — Biological Process — response to UV-B
- GO:0031539 — Biological Process — positive regulation of anthocyanin metabolic process
- GO:0042753 — Biological Process — positive regulation of circadian rhythm
- GO:0080167 — Biological Process — response to karrikin
- GO:0005634 — Cellular Component — nucleus
- GO:0003690 — Molecular Function — double-stranded DNA binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
- GO:0005515 — Molecular Function — protein binding
- GO:0008270 — Molecular Function — zinc ion binding
- GO:0043565 — Molecular Function — sequence-specific DNA binding
Family Introduction:
- The bZIP domain consists of two structural features located on a contiguous alpha-helix: first, a basic region of ~ 16 amino acid residues containing a nuclear localization signal followed by an invariant N-x7-R/K motif that contacts the DNA; and, second, a heptad repeat of leucines or other bulky hydrophobic amino acids positioned exactly nine amino acids towards the C-terminus, creating an amphipathic helix. To bind DNA, two subunits adhere via interactions between the hydrophobic sides of their helices, which creates a superimposing coiled-coil structure. The ability to form homo- and heterodimers is influenced by the electrostatic attraction and repulsion of polar residues flanking the hydrophobic interaction surface of the helices.
- Plant bZIP proteins preferentially bind to DNA sequences with an ACGT core. Binding specificity is regulated by flanking nucleotides. Plant bZIPs preferentially bind to the A-box (TACGTA), C-box (GACGTC) and G-box (CACGTG), but there are also examples of nonpalindromic binding sites.
Literature:
Sequences:
CDS Sequence:
- >Vradi0095s00150.1|Vigna_radiata|bZIP|Vradi0095s00150.1
ATGAAAGGAATGAACTTGTTAGAGTTAGACACCGTTCCGATAGTGGGGCCATTGGCACTTGAAAGAATTTTGATTGCAGGTTGCAGTCTGGTGTTGTCTAAACCCTTGAAGAATTTAAATGGTCAGATTTGTCAAATATGTGGTGATACCATTGGATTAACGGCTACTGGTGATGTCTTTGTTGCTTGTCATGAGTGTGGCTTCCCACTTTGTCATTCTTGTTACGAGTATGAGCTGAAAAATGTGAGCCAATCTTGTCCCCAGTGCAAGACTAGATTCACAAGTCAGCAAGAAGATGCTGACTTCTCTTCATCTTCTGGACATGATTCTCAAATACCAAATCCCCATATAGCAAACGGGCAACCGATGTCTGGTGATATTCCATGTGCTACTTCTGATGCTCAATCTATGCAAACTACATCAGGTCCTATGGCTACTACAAAGCAACCGGGTCTTGAAAGTGATGAAGAGATAAGGAGAGTGCCGGAGATTGGAGGTGAAAGTGCTGGAACTGCAGCCTCTCGGCCGGAAGCTGGTTCAAATGCTGGTGCAGAACGTGCTCAGGGGACGGGAGAGGGTCAGAAGAAGAGAGGGAGAAGCCCAGCTGATAAAGAAAGCAAGCGGCTTAAGAGGCTATTGAGGAACAGAGTTTCGGCCCAACAGGCGAGGGAGAGGAAGAAGGCTTACTTGATTGATTTGGAAACAAGAGTCAAAGACTTGGAGAAGAAGAATTCAGAGCTCAAGGAAAGACTTTCTACTTTGCAGAATGAGAACCAAATGCTTAGACAAATATTGAAGAACACAACAGCAAGCAGGAGAGGGAGCAATAGTGGTACCAATAATGCTGAATGA
Protein Sequence:
- >Vradi0095s00150.1|Vigna_radiata|bZIP|Vradi0095s00150.1
MKGMNLLELDTVPIVGPLALERILIAGCSLVLSKPLKNLNGQICQICGDTIGLTATGDVFVACHECGFPLCHSCYEYELKNVSQSCPQCKTRFTSQQEDADFSSSSGHDSQIPNPHIANGQPMSGDIPCATSDAQSMQTTSGPMATTKQPGLESDEEIRRVPEIGGESAGTAASRPEAGSNAGAERAQGTGEGQKKRGRSPADKESKRLKRLLRNRVSAQQARERKKAYLIDLETRVKDLEKKNSELKERLSTLQNENQMLRQILKNTTASRRGSNSGTNNAE*