Gene Details:

  • Gene ID: Traes_7BL_07CC0B6EF.1
  • Gene Family: bZIP Family
  • Description: bZIP Family protein
  • Species: Triticum aestivum
  • Source: bZIP family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_020167700.1  — basic leucine zipper 9-like isoform X1
  • Refseq:  XP_020167701.1  — basic leucine zipper 9-like isoform X2
  • Swissprot:  Q6ETX0  — RSBZ3_ORYSJ; bZIP transcription factor RISBZ3
  • TrEMBL:  A0A3B6TRJ2  — A0A3B6TRJ2_WHEAT; Uncharacterized protein
  • TrEMBL:  M7ZTE2  — M7ZTE2_TRIUA; Regulatory protein opaque-2
  • TrEMBL:  M8AMI0  — M8AMI0_AEGTA; Regulatory protein opaque-2
  • STRING:  Traes_7BL_07CC0B6EF.1  — (Triticum aestivum)

Gene Ontology:

  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:0005634  — Cellular Component — nucleus
  • GO:0003700  — Molecular Function — transcription factor activity, sequence-specific DNA binding
  • GO:0042803  — Molecular Function — protein homodimerization activity
  • GO:0043565  — Molecular Function — sequence-specific DNA binding
  • GO:0046982  — Molecular Function — protein heterodimerization activity

Family Introduction:

  • The bZIP domain consists of two structural features located on a contiguous alpha-helix: first, a basic region of ~ 16 amino acid residues containing a nuclear localization signal followed by an invariant N-x7-R/K motif that contacts the DNA; and, second, a heptad repeat of leucines or other bulky hydrophobic amino acids positioned exactly nine amino acids towards the C-terminus, creating an amphipathic helix. To bind DNA, two subunits adhere via interactions between the hydrophobic sides of their helices, which creates a superimposing coiled-coil structure. The ability to form homo- and heterodimers is influenced by the electrostatic attraction and repulsion of polar residues flanking the hydrophobic interaction surface of the helices.
  • Plant bZIP proteins preferentially bind to DNA sequences with an ACGT core. Binding specificity is regulated by flanking nucleotides. Plant bZIPs preferentially bind to the A-box (TACGTA), C-box (GACGTC) and G-box (CACGTG), but there are also examples of nonpalindromic binding sites.

Literature:

Sequences:

CDS Sequence:
  • >Traes_7BL_07CC0B6EF.1|Triticum_aestivum|bZIP|Traes_7BL_07CC0B6EF.1
    TTTAGAGTTGGGAAGGAGATTGATAGAGACACACCGGGGTTCTGTCTCACCTGCTGCATTGTTTTGGTCGCAGCTAGCCCGAGGGAAACAATCTCAGGGAACCAGGCTCTCGAAACCGAGTCGGACTCTGACAGCGAGTCATTGGTCGAGATAGGGGGCGGCCGATGCAAGCGGAGCGGCAAATCATCAGATACAAGGCGAATAAGAAGGATGGTGTCCAACAGGGAGTCAGCTCGACGGTCCAGGAGGAGGAAGCACGCGCAGCTAACTGACCTTGAGTTGCAGGTCGAGCAACTTAAAAGCGAAAGTGCAACCCTCTTCAAGCAACTGACAGAGGCCAACCAGCAGTTCACCACCGCAGTCACGGACAACAGAATCCTCAAATCAGATGTAGAGACCTTACGAATCAAGGTAAAAATGGCAGAAGACATGGTAGCTAGAGGAGCGGTGTCCTGCGGCTTAGGACAGCAGCTCGGATTGGCACCATTTCTGAACTCCAGGAAGATGTGA
Protein Sequence:
  • >Traes_7BL_07CC0B6EF.1|Triticum_aestivum|bZIP|Traes_7BL_07CC0B6EF.1
    FRVGKEIDRDTPGFCLTCCIVLVAASPRETISGNQALETESDSDSESLVEIGGGRCKRSGKSSDTRRIRRMVSNRESARRSRRRKHAQLTDLELQVEQLKSESATLFKQLTEANQQFTTAVTDNRILKSDVETLRIKVKMAEDMVARGAVSCGLGQQLGLAPFLNSRKM