Gene Details:

  • Gene ID: Psi005388
  • Gene Family: bZIP Family
  • Description: bZIP Family protein
  • Species: Picea sitchensis
  • Source: bZIP family gene from PlantTFDB

Protein Features:

Annotation Proteins:

Gene Ontology:

  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:0005634  — Cellular Component — nucleus
  • GO:0003700  — Molecular Function — transcription factor activity, sequence-specific DNA binding
  • GO:0043565  — Molecular Function — sequence-specific DNA binding

Family Introduction:

  • The bZIP domain consists of two structural features located on a contiguous alpha-helix: first, a basic region of ~ 16 amino acid residues containing a nuclear localization signal followed by an invariant N-x7-R/K motif that contacts the DNA; and, second, a heptad repeat of leucines or other bulky hydrophobic amino acids positioned exactly nine amino acids towards the C-terminus, creating an amphipathic helix. To bind DNA, two subunits adhere via interactions between the hydrophobic sides of their helices, which creates a superimposing coiled-coil structure. The ability to form homo- and heterodimers is influenced by the electrostatic attraction and repulsion of polar residues flanking the hydrophobic interaction surface of the helices.
  • Plant bZIP proteins preferentially bind to DNA sequences with an ACGT core. Binding specificity is regulated by flanking nucleotides. Plant bZIPs preferentially bind to the A-box (TACGTA), C-box (GACGTC) and G-box (CACGTG), but there are also examples of nonpalindromic binding sites.

Literature:

Sequences:

CDS Sequence:
  • >Psi005388|Picea_sitchensis|bZIP|gnl|UG|Psi#S41649813;PUT-183a-Picea_sitchensis-16039
    ATGCAGGACACTGCCGCCTCCACATCTACACAGCATCAGTCCACAAGTGAAAAGTCTTCAAGTTCAGCAGCACCAGCCCAATTTAGACTAGCCAAAGATGCAATTGAAAGCGATGATGATATCAGGAGGGTTCCTGAAATGGGAGGCATGCAAGCAGGGCCATCTACATGTCTGCCTATGAGGTTAGACAATCCCCAACCCACCACAGGCGTTGTTGCCCACAAGAAGAGAGGGAGAGCCCCTGCAGACAAGGAACACAAGCGTCTCAAAAGATTGCTTAGGAACAGAGTGTCCGCCCAGCAGGCAAGAGAAAGAAAGAAAGCATACTTAAGTGATTTAGAAACAAGGGTTAAAGAGATTGAGCACAAAAACTCTGAGTTAGAGGAAAGGCTTTCCACTTTGCAGAATGAAAATCAGATGCTTAGACAGATTTTGAAGAATACAACAATGAAAAAAAAGGGATCTGGTAACTCAGGAGCAGAAACCTAA
Protein Sequence:
  • >Psi005388|Picea_sitchensis|bZIP|gnl|UG|Psi#S41649813;PUT-183a-Picea_sitchensis-16039
    MQDTAASTSTQHQSTSEKSSSSAAPAQFRLAKDAIESDDDIRRVPEMGGMQAGPSTCLPMRLDNPQPTTGVVAHKKRGRAPADKEHKRLKRLLRNRVSAQQARERKKAYLSDLETRVKEIEHKNSELEERLSTLQNENQMLRQILKNTTMKKKGSGNSGAET