Gene Details:

  • Gene ID: PK09653.2
  • Gene Family: bZIP Family
  • Description: bZIP Family protein
  • Species: Cannabis sativa
  • Source: bZIP family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_024019007.1  — common plant regulatory factor 1
  • Refseq:  XP_024019008.1  — common plant regulatory factor 1
  • Refseq:  XP_024019009.1  — common plant regulatory factor 1
  • Swissprot:  Q99089  — CPRF1_PETCR; Common plant regulatory factor 1
  • TrEMBL:  A0A2P5E8F9  — A0A2P5E8F9_TREOI; Basic-leucine zipper transcription factor
  • STRING:  XP_010092905.1  — (Morus notabilis)

Family Introduction:

  • The bZIP domain consists of two structural features located on a contiguous alpha-helix: first, a basic region of ~ 16 amino acid residues containing a nuclear localization signal followed by an invariant N-x7-R/K motif that contacts the DNA; and, second, a heptad repeat of leucines or other bulky hydrophobic amino acids positioned exactly nine amino acids towards the C-terminus, creating an amphipathic helix. To bind DNA, two subunits adhere via interactions between the hydrophobic sides of their helices, which creates a superimposing coiled-coil structure. The ability to form homo- and heterodimers is influenced by the electrostatic attraction and repulsion of polar residues flanking the hydrophobic interaction surface of the helices.
  • Plant bZIP proteins preferentially bind to DNA sequences with an ACGT core. Binding specificity is regulated by flanking nucleotides. Plant bZIPs preferentially bind to the A-box (TACGTA), C-box (GACGTC) and G-box (CACGTG), but there are also examples of nonpalindromic binding sites.

Literature:

Sequences:

CDS Sequence:
  • >PK09653.2|Cannabis_sativa|bZIP|PK09653.2
    NNGACACCAACTACAGGAGATGAGAAAACTGAGAAGCAGATCAACTCAGTGTCTGATAAGATAATGGGTGCATCTTTCTCTGCTGCTGGCGTATCAGCAAAGTTAGTTGGACCTGTACTTTCCCCTGGTATGACCACGGCATTTGATCTCAGAAACCCTACTAACTTGAGCCCCAAGACCAGTCCATCTGGCTTCAACCAAACTTGTACGGTCTTGCCTTCGGACTCCTGGGTGCCGAATGATCGGGAATTGAAGCGTGAAAGAAGGAAACAGTCTAACCGAGAATCTGCTAGGAGGTNN
Protein Sequence:
  • >PK09653.2|Cannabis_sativa|bZIP|PK09653.2
    XTPTTGDEKTEKQINSVSDKIMGASFSAAGVSAKLVGPVLSPGMTTAFDLRNPTNLSPKTSPSGFNQTCTVLPSDSWVPNDRELKRERRKQSNRESARRX