Gene Details:

  • Gene ID: PEQU_40289
  • Gene Family: bZIP Family
  • Description: bZIP Family protein
  • Species: Phalaenopsis equestris
  • Source: bZIP family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_009388964.1  — PREDICTED: homeobox-leucine zipper protein HOX32-like
  • Refseq:  XP_020578111.1  — homeobox-leucine zipper protein HOX32-like
  • Swissprot:  A2XK30  — HOX32_ORYSI; Homeobox-leucine zipper protein HOX32
  • Swissprot:  Q6AST1  — HOX32_ORYSJ; Homeobox-leucine zipper protein HOX32
  • TrEMBL:  A0A2G9GPZ1  — A0A2G9GPZ1_9LAMI; Uncharacterized protein
  • TrEMBL:  M0S7J6  — M0S7J6_MUSAM; Uncharacterized protein
  • STRING:  GSMUA_Achr2P13050_001  — (Musa acuminata)

Family Introduction:

  • The bZIP domain consists of two structural features located on a contiguous alpha-helix: first, a basic region of ~ 16 amino acid residues containing a nuclear localization signal followed by an invariant N-x7-R/K motif that contacts the DNA; and, second, a heptad repeat of leucines or other bulky hydrophobic amino acids positioned exactly nine amino acids towards the C-terminus, creating an amphipathic helix. To bind DNA, two subunits adhere via interactions between the hydrophobic sides of their helices, which creates a superimposing coiled-coil structure. The ability to form homo- and heterodimers is influenced by the electrostatic attraction and repulsion of polar residues flanking the hydrophobic interaction surface of the helices.
  • Plant bZIP proteins preferentially bind to DNA sequences with an ACGT core. Binding specificity is regulated by flanking nucleotides. Plant bZIPs preferentially bind to the A-box (TACGTA), C-box (GACGTC) and G-box (CACGTG), but there are also examples of nonpalindromic binding sites.

Literature:

Sequences:

CDS Sequence:
  • >PEQU_40289|Phalaenopsis_equestris|bZIP|PEQU_40289
    TGCCGTGAGAAGCAGAGAAAAGAGGCGTCTCGTCTCCAAACCGTCAATCGAAAGCTAACTGCTATGAACAAGCTCCTGATGGAGGAGAATGACCGCTTGCAAAAGCAGGTGTCACACTTAGTTTATGAGAATGGATACATGCGTCAACAGCTTCATATT
Protein Sequence:
  • >PEQU_40289|Phalaenopsis_equestris|bZIP|PEQU_40289
    CREKQRKEASRLQTVNRKLTAMNKLLMEENDRLQKQVSHLVYENGYMRQQLHI