Gene Details:

Protein Features:

Annotation Proteins:

  • Refseq:  XP_009790491.1  — PREDICTED: uncharacterized protein At4g06598-like isoform X1
  • Refseq:  XP_009790492.1  — PREDICTED: uncharacterized protein At4g06598-like isoform X1
  • Refseq:  XP_016512674.1  — PREDICTED: uncharacterized protein At4g06598-like
  • Swissprot:  Q9M2K4  — BZP61_ARATH; Basic leucine zipper 61
  • TrEMBL:  A0A1S4DHD5  — A0A1S4DHD5_TOBAC; uncharacterized protein At4g06598-like
  • TrEMBL:  A0A1U7XLK7  — A0A1U7XLK7_NICSY; uncharacterized protein At4g06598-like isoform X1
  • TrEMBL:  M1CBU6  — M1CBU6_SOLTU; Uncharacterized protein
  • STRING:  XP_009790491.1  — (Nicotiana sylvestris)

Family Introduction:

  • The bZIP domain consists of two structural features located on a contiguous alpha-helix: first, a basic region of ~ 16 amino acid residues containing a nuclear localization signal followed by an invariant N-x7-R/K motif that contacts the DNA; and, second, a heptad repeat of leucines or other bulky hydrophobic amino acids positioned exactly nine amino acids towards the C-terminus, creating an amphipathic helix. To bind DNA, two subunits adhere via interactions between the hydrophobic sides of their helices, which creates a superimposing coiled-coil structure. The ability to form homo- and heterodimers is influenced by the electrostatic attraction and repulsion of polar residues flanking the hydrophobic interaction surface of the helices.
  • Plant bZIP proteins preferentially bind to DNA sequences with an ACGT core. Binding specificity is regulated by flanking nucleotides. Plant bZIPs preferentially bind to the A-box (TACGTA), C-box (GACGTC) and G-box (CACGTG), but there are also examples of nonpalindromic binding sites.

Literature:

Sequences:

CDS Sequence:
  • >Peaxi162Scf03393g00015.1|Petunia_axillaris|bZIP|Peaxi162Scf03393g00015.1
    ATGATTCTTGTTATGAAATACACTGTTCCTGAACAGTGGTGGATGTCCAATCCACTGTTCCTGAACAATGGATTGTCTGTTCCTGAACAGTGGTGGATGTCCAATCCACTGTTCCTTAACAGTGGATTGCAATTCGCTCAGCGGTCACGTGTGCGGAAGCTTCAATACATATCTGAACTGGAAAGAAATGTACAAGTTCTGCAGGTTGAAGGTTCTGAAGTGTCTGCTGAGCTTGAATTCCTTAACCAGCAGAATCTTATTCTCAGTATGGAGAATAAAGCCCTAAAACAGCGCTTAGAAAATTTAGCTCAAGAACAGCTGATAAAGTATTTGGAGCATGAAGTACTGGAAAGAGAAAGAGGAAGACTACGATCATTATATCAGCAACAACAATTTCCACAATCGCAGCAGAAACAACAATCATCTTCCAGCCATCGGCGCACCACTAGTAGGGATCTCGATCAGCAATTTGCAGACCTCTCTTTGAAACAAAAAGAGGGTTCAGGCCAACTTCACATGTGA
Protein Sequence:
  • >Peaxi162Scf03393g00015.1|Petunia_axillaris|bZIP|Peaxi162Scf03393g00015.1
    MILVMKYTVPEQWWMSNPLFLNNGLSVPEQWWMSNPLFLNSGLQFAQRSRVRKLQYISELERNVQVLQVEGSEVSAELEFLNQQNLILSMENKALKQRLENLAQEQLIKYLEHEVLERERGRLRSLYQQQQFPQSQQKQQSSSSHRRTTSRDLDQQFADLSLKQKEGSGQLHM