Gene Details:
- Gene ID: ORGLA12G0138000.1
- Gene Family: bZIP Family
- Description: bZIP Family protein
- Species: Oryza glaberrima
- Source: bZIP family gene from PlantTFDB
Protein Features:
- SMART: SM00338
- Gene3D: G3DSA:1.20.5.170
- PROSITE profile: PS50217
- Pfam: PF00170
- SuperFamily: SSF57959
- PROSITE pattern: PS00036
- InterPro: IPR004827
Annotation Proteins:
- Refseq: XP_015619873.1 — ocs element-binding factor 1
- Swissprot: P24068 — OCS1_MAIZE; Ocs element-binding factor 1
- TrEMBL: A0A0D3HVP5 — A0A0D3HVP5_9ORYZ; Uncharacterized protein
- TrEMBL: A0A0E0BU26 — A0A0E0BU26_9ORYZ; Uncharacterized protein
- TrEMBL: A0A0E0CHQ3 — A0A0E0CHQ3_9ORYZ; Uncharacterized protein
- TrEMBL: A0A0E0JB71 — A0A0E0JB71_ORYNI; Uncharacterized protein
- TrEMBL: A0A0E0RIR1 — A0A0E0RIR1_ORYRU; Uncharacterized protein
- TrEMBL: A2ZLM8 — A2ZLM8_ORYSI; Uncharacterized protein
- TrEMBL: I1R774 — I1R774_ORYGL; Uncharacterized protein
- TrEMBL: Q4H4C4 — Q4H4C4_ORYSJ; BZIP protein
- STRING: OGLUM12G17310.1 — (Oryza glumipatula)
- STRING: OMERI02G09370.1 — (Oryza meridionalis)
- STRING: ORUFI12G17520.1 — (Oryza rufipogon)
- STRING: ONIVA12G14510.1 — (Oryza nivara)
- STRING: ORGLA11G0215100.1 — (Oryza glaberrima)
- STRING: ORGLA12G0138000.1 — (Oryza glaberrima)
- STRING: OBART12G15770.1 — (Oryza barthii)
Gene Ontology:
- GO:0006971 — Biological Process — hypotonic response
- GO:0009267 — Biological Process — cellular response to starvation
- GO:0045893 — Biological Process — positive regulation of transcription, DNA-templated
- GO:2000693 — Biological Process — positive regulation of seed maturation
- GO:0005634 — Cellular Component — nucleus
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
- GO:0043565 — Molecular Function — sequence-specific DNA binding
- GO:0046982 — Molecular Function — protein heterodimerization activity
Family Introduction:
- The bZIP domain consists of two structural features located on a contiguous alpha-helix: first, a basic region of ~ 16 amino acid residues containing a nuclear localization signal followed by an invariant N-x7-R/K motif that contacts the DNA; and, second, a heptad repeat of leucines or other bulky hydrophobic amino acids positioned exactly nine amino acids towards the C-terminus, creating an amphipathic helix. To bind DNA, two subunits adhere via interactions between the hydrophobic sides of their helices, which creates a superimposing coiled-coil structure. The ability to form homo- and heterodimers is influenced by the electrostatic attraction and repulsion of polar residues flanking the hydrophobic interaction surface of the helices.
- Plant bZIP proteins preferentially bind to DNA sequences with an ACGT core. Binding specificity is regulated by flanking nucleotides. Plant bZIPs preferentially bind to the A-box (TACGTA), C-box (GACGTC) and G-box (CACGTG), but there are also examples of nonpalindromic binding sites.
Literature:
Sequences:
CDS Sequence:
- >ORGLA12G0138000.1|Oryza_glaberrima|bZIP|ORGLA12G0138000.1
ATGTCGTCGTCGTCGCTGTCGCCGGCGGGGTCGTCGGACGGGGACTCGGCGGGGGTGGTGGTGGCGGCGGACCACCGGAGGGAGAAGCGGCGGCTGTCGAACAGGGAGTCGGCGAGGCGGTCGCGGCTGCGGAAGCAGCAGCACCTGGACGAGCTGGTGCAGGAGGTGGCGAGGCTGCAGGCGGACAACGCGCGCGTGCTGGCGCGCGCCAGCGAAATCGCCGGGCAGTACGCGCGCGTGGAGCAGGAGAACACGGTGCTCCGGGCGCGCGCCGCCGAGCTCGGCGACAGGCTGCGCAGCGTCAACGAGGTGCTCCGCGTCGTCGAGGAGTTCAGCGGCGTCGCCATGGACATCCAGGAGGAGTGCCCCCCCGACGACCCGCTGCTCCGGCCATGGCAGATCCCCTGCCCCGCCGCCGCGCACATGCTCCAGTACTGA
Protein Sequence:
- >ORGLA12G0138000.1|Oryza_glaberrima|bZIP|ORGLA12G0138000.1
MSSSSLSPAGSSDGDSAGVVVAADHRREKRRLSNRESARRSRLRKQQHLDELVQEVARLQADNARVLARASEIAGQYARVEQENTVLRARAAELGDRLRSVNEVLRVVEEFSGVAMDIQEECPPDDPLLRPWQIPCPAAAHMLQY