Gene Details:

  • Gene ID: OMERI02G09390.1
  • Gene Family: bZIP Family
  • Description: bZIP Family protein
  • Species: Oryza meridionalis
  • Source: bZIP family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_015619873.1  — ocs element-binding factor 1
  • Swissprot:  P24068  — OCS1_MAIZE; Ocs element-binding factor 1
  • TrEMBL:  A0A0D3HVP5  — A0A0D3HVP5_9ORYZ; Uncharacterized protein
  • TrEMBL:  A0A0E0BU26  — A0A0E0BU26_9ORYZ; Uncharacterized protein
  • TrEMBL:  A0A0E0CHQ3  — A0A0E0CHQ3_9ORYZ; Uncharacterized protein
  • TrEMBL:  A0A0E0JB71  — A0A0E0JB71_ORYNI; Uncharacterized protein
  • TrEMBL:  A0A0E0RIR1  — A0A0E0RIR1_ORYRU; Uncharacterized protein
  • TrEMBL:  A2ZLM8  — A2ZLM8_ORYSI; Uncharacterized protein
  • TrEMBL:  I1R774  — I1R774_ORYGL; Uncharacterized protein
  • TrEMBL:  Q4H4C4  — Q4H4C4_ORYSJ; BZIP protein
  • STRING:  OGLUM12G17310.1  — (Oryza glumipatula)
  • STRING:  OMERI02G09370.1  — (Oryza meridionalis)
  • STRING:  ORUFI12G17520.1  — (Oryza rufipogon)
  • STRING:  ONIVA12G14510.1  — (Oryza nivara)
  • STRING:  ORGLA11G0215100.1  — (Oryza glaberrima)
  • STRING:  ORGLA12G0138000.1  — (Oryza glaberrima)
  • STRING:  OBART12G15770.1  — (Oryza barthii)

Gene Ontology:

  • GO:0006971  — Biological Process — hypotonic response
  • GO:0009267  — Biological Process — cellular response to starvation
  • GO:0045893  — Biological Process — positive regulation of transcription, DNA-templated
  • GO:2000693  — Biological Process — positive regulation of seed maturation
  • GO:0005634  — Cellular Component — nucleus
  • GO:0003700  — Molecular Function — transcription factor activity, sequence-specific DNA binding
  • GO:0043565  — Molecular Function — sequence-specific DNA binding
  • GO:0046982  — Molecular Function — protein heterodimerization activity

Family Introduction:

  • The bZIP domain consists of two structural features located on a contiguous alpha-helix: first, a basic region of ~ 16 amino acid residues containing a nuclear localization signal followed by an invariant N-x7-R/K motif that contacts the DNA; and, second, a heptad repeat of leucines or other bulky hydrophobic amino acids positioned exactly nine amino acids towards the C-terminus, creating an amphipathic helix. To bind DNA, two subunits adhere via interactions between the hydrophobic sides of their helices, which creates a superimposing coiled-coil structure. The ability to form homo- and heterodimers is influenced by the electrostatic attraction and repulsion of polar residues flanking the hydrophobic interaction surface of the helices.
  • Plant bZIP proteins preferentially bind to DNA sequences with an ACGT core. Binding specificity is regulated by flanking nucleotides. Plant bZIPs preferentially bind to the A-box (TACGTA), C-box (GACGTC) and G-box (CACGTG), but there are also examples of nonpalindromic binding sites.

Literature:

Sequences:

CDS Sequence:
  • >OMERI02G09390.1|Oryza_meridionalis|bZIP|OMERI02G09390.1
    ATGTCGTCGTCGTCGCTGTCGCCGGCGGGGTCGTCGGACGGGGACTCGGCGGGGGTGGTGGTGGCGGCGGACCACCGGAGGGAGAAGCGGCGGCTGTCGAACAGGGAGTCGGCGAGGCGGTCGCGGCTGCGGAAGCAGCAGCACCTGGACGAGCTGGTGCAGGAGGTGGCGAGGCTGCAGGCGGACAACGCGCGCGTGCTGGCGCGCGCCAGCGAAATCGCCGGGCAGTACGCGCGCGTGGAGCAGGAGAACACGGTGCTCCGGGCGCGCGCCGCCGAGCTCGGCGACAGGCTGCGCAGCGTCAACGAGGTGCTCCGCGTCGTCGAGGAGTTCAGCGGCGTCGCCATGGACATCCAGGAGGAGTGCCCCCCCGACGACCCGCTGCTCCGGCCATGGCAGATCCCCTGCCCCGCCGCCGCGCACATGCTCCAGTACTGA
Protein Sequence:
  • >OMERI02G09390.1|Oryza_meridionalis|bZIP|OMERI02G09390.1
    MSSSSLSPAGSSDGDSAGVVVAADHRREKRRLSNRESARRSRLRKQQHLDELVQEVARLQADNARVLARASEIAGQYARVEQENTVLRARAAELGDRLRSVNEVLRVVEEFSGVAMDIQEECPPDDPLLRPWQIPCPAAAHMLQY