Gene Details:
- Gene ID: Niben101Scf02915g06006.1
- Gene Family: bZIP Family
- Description: bZIP Family protein
- Species: Nicotiana benthamiana
- Source: bZIP family gene from PlantTFDB
Protein Features:
- SMART: SM00338
- Gene3D: G3DSA:1.20.5.170
- PROSITE profile: PS50217
- Pfam: PF00170
- SuperFamily: SSF57959
- PROSITE pattern: PS00036
- InterPro: IPR004827
Family Introduction:
- The bZIP domain consists of two structural features located on a contiguous alpha-helix: first, a basic region of ~ 16 amino acid residues containing a nuclear localization signal followed by an invariant N-x7-R/K motif that contacts the DNA; and, second, a heptad repeat of leucines or other bulky hydrophobic amino acids positioned exactly nine amino acids towards the C-terminus, creating an amphipathic helix. To bind DNA, two subunits adhere via interactions between the hydrophobic sides of their helices, which creates a superimposing coiled-coil structure. The ability to form homo- and heterodimers is influenced by the electrostatic attraction and repulsion of polar residues flanking the hydrophobic interaction surface of the helices.
- Plant bZIP proteins preferentially bind to DNA sequences with an ACGT core. Binding specificity is regulated by flanking nucleotides. Plant bZIPs preferentially bind to the A-box (TACGTA), C-box (GACGTC) and G-box (CACGTG), but there are also examples of nonpalindromic binding sites.
Literature:
Sequences:
CDS Sequence:
- >Niben101Scf02915g06006.1|Nicotiana_benthamiana|bZIP|Niben101Scf02915g06006.1
Protein Sequence:
- >Niben101Scf02915g06006.1|Nicotiana_benthamiana|bZIP|Niben101Scf02915g06006.1
MVCSGRLADSSTGGDCCVTGPLLEVDDGLVMLLLDGGRRSSVSGEGRLDRARRSRMRKQQRLREFMSETTQLHKQNSIFRERIDSVERNRKSTIIRD