MLOC_71198.1

Gene Details:

GO:0006355 — Biological Process — regulation of transcription, DNA-templated
GO:0007231 — Biological Process — osmosensory signaling pathway
GO:0008272 — Biological Process — sulfate transport
GO:0009294 — Biological Process — DNA mediated transformation
GO:0009652 — Biological Process — thigmotropism
GO:0009970 — Biological Process — cellular response to sulfate starvation
GO:0045596 — Biological Process — negative regulation of cell differentiation
GO:0051170 — Biological Process — nuclear import
GO:0005634 — Cellular Component — nucleus
GO:0005829 — Cellular Component — cytosol
GO:0003682 — Molecular Function — chromatin binding
GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
GO:0043565 — Molecular Function — sequence-specific DNA binding
GO:0043621 — Molecular Function — protein self-association
GO:0051019 — Molecular Function — mitogen-activated protein kinase binding

The bZIP domain consists of two structural features located on a contiguous alpha-helix: first, a basic region of ~ 16 amino acid residues containing a nuclear localization signal followed by an invariant N-x7-R/K motif that contacts the DNA; and, second, a heptad repeat of leucines or other bulky hydrophobic amino acids positioned exactly nine amino acids towards the C-terminus, creating an amphipathic helix. To bind DNA, two subunits adhere via interactions between the hydrophobic sides of their helices, which creates a superimposing coiled-coil structure. The ability to form homo- and heterodimers is influenced by the electrostatic attraction and repulsion of polar residues flanking the hydrophobic interaction surface of the helices.
Plant bZIP proteins preferentially bind to DNA sequences with an ACGT core. Binding specificity is regulated by flanking nucleotides. Plant bZIPs preferentially bind to the A-box (TACGTA), C-box (GACGTC) and G-box (CACGTG), but there are also examples of nonpalindromic binding sites.

CDS Sequence:

>MLOC_71198.1|Hordeum_vulgare|bZIP|MLOC_71198.1
ATGGACCCGCGCTTCCCGCCGCCGGCGCCGTCCTCTGCTGGCGGTGCGCCGCGCGGCCACCGGCGGGCCCACTCCGAGACCTTCATCCGGTTCCCCGACGCGGACCTGCTGCTCGACCCGGACAGCGACTTCTCCTTCTCCGACCTCGACTTCCCCTCCCTCTCCGACGACTCCCCCGCCGTCTCCTCCGATCCCACCCCGCCTCCCCCGCCGCTGCCGCCGCACCAGTCCCCGTCGCCGGCGCCGCGCCCGCCCGGTGCCGGGGGCGCGCATATGAGGAGCCTCTCGCTCGACGCCGCCTTCTTCGACGGCCTCGCGCTGCAGGGAGGAGGCGGAGGCGGGGCTGGGCATAAGAGGAGCGGCTCCATGGATGGAGCAAGCTCGCCGTCCGACGGCGAGTCTGCGCTGTCCGGTGGGCTACCGGACTACGCCAAGAAGGCCATTCCCGCGGAGAGGCTCGCTGAGCTCGCGCTCCTCGACCCCAAGCGCGCTAAGAGGATTTTGGCCAACAGGCAGTCGGCCGCGAGGTCCAAGGAGAGGAAGATCAAGTACACCGGCGAGCTGGAGAGGAAGGTGCAGACGCTGCAGACAGAGGCGACCACGCTCTCTGCACAGCTCACGCTTCTTCAGAGGGATACTTCCGGTTTAACTGTTGAGAACAGAGAGCTCAAACTCCGGTTGCAGTCCATGGAAGAACAAGCCAAACTTCGAGATGCTCTGAATGATGCCTTGAGAGAAGAAGTCCAGCGGCTTAAGATAGCGGCAGGTCAAGTTCCAAGCATGAATGGACACCCCTTCGGTGGAGGGCTACAGCAGCAGCAGCAGCAAATGCAGAACTATTTCTCGCAGCAGCAGCAGATGCACTACCAAGGCCATCAGCATCACCACCCCCAAAACCACCCTCAGAATTCTTCGAACGGAGGCCAGTCGCTCAGTGGCCAGTCTCTAAGCGACTCCATGGATTTCATGTGA

Protein Sequence:

>MLOC_71198.1|Hordeum_vulgare|bZIP|MLOC_71198.1
MDPRFPPPAPSSAGGAPRGHRRAHSETFIRFPDADLLLDPDSDFSFSDLDFPSLSDDSPAVSSDPTPPPPPLPPHQSPSPAPRPPGAGGAHMRSLSLDAAFFDGLALQGGGGGGAGHKRSGSMDGASSPSDGESALSGGLPDYAKKAIPAERLAELALLDPKRAKRILANRQSAARSKERKIKYTGELERKVQTLQTEATTLSAQLTLLQRDTSGLTVENRELKLRLQSMEEQAKLRDALNDALREEVQRLKIAAGQVPSMNGHPFGGGLQQQQQQMQNYFSQQQQMHYQGHQHHHPQNHPQNSSNGGQSLSGQSLSDSMDFM