Gene Details:
- Gene ID: LOC_Os02g58670.1
- Gene Name: LOC4331270, OJ1282_E10.14, Os02g0833600, OsJ_09015, OSNPB_020833600
- Gene Family: bZIP Family
- Description: bZIP Family protein
- Species: Oryza sativa subsp. japonica
- Source: bZIP family gene from PlantTFDB
Protein Features:
- SMART: SM00338
- Gene3D: G3DSA:1.20.5.170
- PROSITE profile: PS50217
- Pfam: PF00170
- SuperFamily: SSF57959
- PROSITE pattern: PS00036
- InterPro: IPR004827
Annotation Proteins:
- Refseq: XP_015623884.1 — protein FD
- Swissprot: Q84JK2 — FD_ARATH; Protein FD
- TrEMBL: A0A0D3FCJ0 — A0A0D3FCJ0_9ORYZ; Uncharacterized protein
- TrEMBL: A0A0E0GFF8 — A0A0E0GFF8_ORYNI; Uncharacterized protein
- TrEMBL: A0A0E0NNE1 — A0A0E0NNE1_ORYRU; Uncharacterized protein
- TrEMBL: A2XBE0 — A2XBE0_ORYSI; Uncharacterized protein
- TrEMBL: I1P5X3 — I1P5X3_ORYGL; Uncharacterized protein
- TrEMBL: Q6ESB3 — Q6ESB3_ORYSJ; Os02g0833600 protein
- STRING: ORUFI02G40230.1 — (Oryza rufipogon)
- STRING: OS02T0833600-01 — (Oryza sativa)
- STRING: ONIVA02G41380.1 — (Oryza nivara)
- STRING: ORGLA02G0337900.1 — (Oryza glaberrima)
- STRING: OBART02G38520.1 — (Oryza barthii)
Gene Ontology:
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0005634 — Cellular Component — nucleus
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
- GO:0043565 — Molecular Function — sequence-specific DNA binding
Family Introduction:
- The bZIP domain consists of two structural features located on a contiguous alpha-helix: first, a basic region of ~ 16 amino acid residues containing a nuclear localization signal followed by an invariant N-x7-R/K motif that contacts the DNA; and, second, a heptad repeat of leucines or other bulky hydrophobic amino acids positioned exactly nine amino acids towards the C-terminus, creating an amphipathic helix. To bind DNA, two subunits adhere via interactions between the hydrophobic sides of their helices, which creates a superimposing coiled-coil structure. The ability to form homo- and heterodimers is influenced by the electrostatic attraction and repulsion of polar residues flanking the hydrophobic interaction surface of the helices.
- Plant bZIP proteins preferentially bind to DNA sequences with an ACGT core. Binding specificity is regulated by flanking nucleotides. Plant bZIPs preferentially bind to the A-box (TACGTA), C-box (GACGTC) and G-box (CACGTG), but there are also examples of nonpalindromic binding sites.
Literature:
Sequences:
CDS Sequence:
- >LOC_Os02g58670.1|Oryza_sativa_subsp._japonica|bZIP|LOC_Os02g58670.1
ATGGCGGAGCAGCTGGGCGGCGTGGGCAGCCCGCAGCTAAGCCTGAGCAGCTGCAGCTCCTTCCTTTCCATCTCCAGCGCCGGTACCAGCGCCGCCGATGGTGCTCCCCATCTATCCCTCGGCGTGGGCGGCGCCGAGGAGCTGGATCTGCTGCTGCAGGTGGGCATAGGCGGTGGCGGTGGCGGCGGCGGCGACGAGGAAGAGGAGGAGCGCAAGACCATCCGGATGATGAAGAACAGGGAGTCGGCGCTGCGCTCCAGGGCAAGGAAGAGGGCGTATGTGCAGGAGCTGGAGAAGGAAGTTCGCCGGCTGGTGAATGAGAATCTCAAGCTCAAGAGGCACTGCAAACAACTTAAGACGGAGATGGCTGCTCTGATCCAGCAGCCTACCAACAAGCAGAGTTCCCACCGAAGAAGCTCATCCACTTGA
Protein Sequence:
- >LOC_Os02g58670.1|Oryza_sativa_subsp._japonica|bZIP|LOC_Os02g58670.1
MAEQLGGVGSPQLSLSSCSSFLSISSAGTSAADGAPHLSLGVGGAEELDLLLQVGIGGGGGGGGDEEEEERKTIRMMKNRESALRSRARKRAYVQELEKEVRRLVNENLKLKRHCKQLKTEMAALIQQPTNKQSSHRRSSST*