Gene Details:

  • Gene ID: Gh_D06G0331
  • Gene Family: bZIP Family
  • Description: bZIP Family protein
  • Species: Gossypium hirsutum
  • Source: bZIP family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_012438631.1  — PREDICTED: transcription factor HBP-1b(c38)-like
  • Refseq:  XP_016703669.1  — PREDICTED: transcription factor HBP-1b(c38)-like isoform X1
  • Refseq:  XP_016703670.1  — PREDICTED: transcription factor HBP-1b(c38)-like isoform X1
  • Refseq:  XP_016703671.1  — PREDICTED: transcription factor HBP-1b(c38)-like isoform X2
  • Refseq:  XP_017641831.1  — PREDICTED: transcription factor HBP-1b(c38)-like
  • Swissprot:  Q5Z6N9  — TGAL3_ORYSJ; Transcription factor TGAL3
  • TrEMBL:  A0A0B0NQX8  — A0A0B0NQX8_GOSAR; Transcription factor PERIANTHIA-like protein
  • TrEMBL:  A0A0D2PX51  — A0A0D2PX51_GOSRA; Uncharacterized protein
  • TrEMBL:  A0A0D2T8B5  — A0A0D2T8B5_GOSRA; Uncharacterized protein
  • TrEMBL:  A0A1U8KMF9  — A0A1U8KMF9_GOSHI; transcription factor HBP-1b(C38)-like isoform X2
  • TrEMBL:  A0A1U8KMK4  — A0A1U8KMK4_GOSHI; transcription factor HBP-1b(C38)-like isoform X1
  • TrEMBL:  A0A2P5W3Z9  — A0A2P5W3Z9_GOSBA; Uncharacterized protein
  • STRING:  Gorai.008G185000.1  — (Gossypium raimondii)

Gene Ontology:

  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:0003700  — Molecular Function — transcription factor activity, sequence-specific DNA binding
  • GO:0043565  — Molecular Function — sequence-specific DNA binding

Family Introduction:

  • The bZIP domain consists of two structural features located on a contiguous alpha-helix: first, a basic region of ~ 16 amino acid residues containing a nuclear localization signal followed by an invariant N-x7-R/K motif that contacts the DNA; and, second, a heptad repeat of leucines or other bulky hydrophobic amino acids positioned exactly nine amino acids towards the C-terminus, creating an amphipathic helix. To bind DNA, two subunits adhere via interactions between the hydrophobic sides of their helices, which creates a superimposing coiled-coil structure. The ability to form homo- and heterodimers is influenced by the electrostatic attraction and repulsion of polar residues flanking the hydrophobic interaction surface of the helices.
  • Plant bZIP proteins preferentially bind to DNA sequences with an ACGT core. Binding specificity is regulated by flanking nucleotides. Plant bZIPs preferentially bind to the A-box (TACGTA), C-box (GACGTC) and G-box (CACGTG), but there are also examples of nonpalindromic binding sites.

Literature:

Sequences:

CDS Sequence:
  • >Gh_D06G0331|Gossypium_hirsutum|bZIP|Gh_D06G0331
    ATGGTGAATACGGTGGATCAATCCAAGTCAAAAAGTGGTTATCAAAAGACACTTCGCAAGCTTGCTCAGAATCGAAAAGCTGCAAGAAAGAGTAGATTGAGGAAAAAAGCTTATGTCCAGCAGCTTGAGAGTAGTCAACTCAGGCTTTCAGAAATAGAGCAAGAGCTTCAAAAGGCACGGCAGCAGGGTATTTTTATCACATCTGGACTTTCTGGGGACCATGGCCATACAGTTGCGGGAAATGCTGCTCTGGGATTTGACATGGAATATGGTCGCTGGCTTGATGAACATCAACGACTGATAAATGACTTAAGATTAGCTGTAAATTCTCATATGGGAGATAATGAATTGTGCATTCTTGTTGGGGTGTCATGGCACATTATGATGAGGTTTACAGGCTAA
Protein Sequence:
  • >Gh_D06G0331|Gossypium_hirsutum|bZIP|Gh_D06G0331
    MVNTVDQSKSKSGYQKTLRKLAQNRKAARKSRLRKKAYVQQLESSQLRLSEIEQELQKARQQGIFITSGLSGDHGHTVAGNAALGFDMEYGRWLDEHQRLINDLRLAVNSHMGDNELCILVGVSWHIMMRFTG