Gene Details:

Protein Features:

Annotation Proteins:

  • Refseq:  XP_012071654.1  — ABSCISIC ACID-INSENSITIVE 5-like protein 5
  • Refseq:  XP_018805792.1  — PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform X2
  • Refseq:  XP_018805793.1  — PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform X2
  • Refseq:  XP_020534831.1  — ABSCISIC ACID-INSENSITIVE 5-like protein 5
  • Swissprot:  Q9M7Q4  — AI5L5_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 5
  • TrEMBL:  A0A067D5D2  — A0A067D5D2_CITSI; Uncharacterized protein
  • TrEMBL:  A0A067GWQ2  — A0A067GWQ2_CITSI; Uncharacterized protein
  • TrEMBL:  A0A067L1G8  — A0A067L1G8_JATCU; Uncharacterized protein
  • TrEMBL:  A0A2I4DF73  — A0A2I4DF73_JUGRE; ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform X2
  • STRING:  evm.model.supercontig_49.26  — (Carica papaya)

Gene Ontology:

  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:0003700  — Molecular Function — transcription factor activity, sequence-specific DNA binding
  • GO:0043565  — Molecular Function — sequence-specific DNA binding

Family Introduction:

  • The bZIP domain consists of two structural features located on a contiguous alpha-helix: first, a basic region of ~ 16 amino acid residues containing a nuclear localization signal followed by an invariant N-x7-R/K motif that contacts the DNA; and, second, a heptad repeat of leucines or other bulky hydrophobic amino acids positioned exactly nine amino acids towards the C-terminus, creating an amphipathic helix. To bind DNA, two subunits adhere via interactions between the hydrophobic sides of their helices, which creates a superimposing coiled-coil structure. The ability to form homo- and heterodimers is influenced by the electrostatic attraction and repulsion of polar residues flanking the hydrophobic interaction surface of the helices.
  • Plant bZIP proteins preferentially bind to DNA sequences with an ACGT core. Binding specificity is regulated by flanking nucleotides. Plant bZIPs preferentially bind to the A-box (TACGTA), C-box (GACGTC) and G-box (CACGTG), but there are also examples of nonpalindromic binding sites.

Literature:

Sequences:

CDS Sequence:
  • >evm.model.supercontig_49.26|Carica_papaya|bZIP|evm.model.supercontig_49.26
    ATGGCAACTAATTTCAACTTGAAGAACTTCGGTAACGAACCGCTTGCCGACGGCGGCACTTCCGGTAATAGACCGCTGGCCAATGTTCCCTTGACCCGTCAACCATCCGGTCGAGCCATGGGAGTGGGTCTCCTGCAAACCCAGCTGTCATCAAATGGAATTGGTAAGAATAATGGAGATACATCTTCTGTATCGCCTGTCCCTTATGCCTTTAATGGAGGTTTTAGAGGGAGGAAATGCAGTGGGGCTGTGGAGAAAGTTGTTGAGAGGAGACAGAGGAGAATGATAAAGAACAGAGAATCAGCAGCAAGGTCTCGGGCACGTAAGCAGGCTTATACCATGGAGTTGGAAGCAGAAGTTGCTAAGTTAAAGGAGGAGAACGAAGAATTGCAAAAGAAACAGGAAAAGATTATGGAAATGCAGAAGAATCAGGTGTTAGAGATGTTGAACGGACAGCGCGGATCTAAATTGCGGTGCTTGAGACGAACACAGACTGGTCCATGGTAG
Protein Sequence:
  • >evm.model.supercontig_49.26|Carica_papaya|bZIP|evm.model.supercontig_49.26
    MATNFNLKNFGNEPLADGGTSGNRPLANVPLTRQPSGRAMGVGLLQTQLSSNGIGKNNGDTSSVSPVPYAFNGGFRGRKCSGAVEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENEELQKKQEKIMEMQKNQVLEMLNGQRGSKLRCLRRTQTGPW*