Information report for EMT18702
Gene Details
Functional Annotation
- Refseq: XP_020184631.1 — bZIP transcription factor 50
- Swissprot: Q69XV0 — BZP50_ORYSJ; bZIP transcription factor 50
- TrEMBL: R7W983 — R7W983_AEGTA; BZIP transcription factor 60
- STRING: EMT18702 — (Aegilops tauschii)
- GO:0000165 — Biological Process — MAPK cascade
- GO:0002679 — Biological Process — respiratory burst involved in defense response
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0006612 — Biological Process — protein targeting to membrane
- GO:0006984 — Biological Process — ER-nucleus signaling pathway
- GO:0009409 — Biological Process — response to cold
- GO:0009410 — Biological Process — response to xenobiotic stimulus
- GO:0009693 — Biological Process — ethylene biosynthetic process
- GO:0009738 — Biological Process — abscisic acid-activated signaling pathway
- GO:0009867 — Biological Process — jasmonic acid mediated signaling pathway
- GO:0010200 — Biological Process — response to chitin
- GO:0010286 — Biological Process — heat acclimation
- GO:0010363 — Biological Process — regulation of plant-type hypersensitive response
- GO:0030968 — Biological Process — endoplasmic reticulum unfolded protein response
- GO:0031348 — Biological Process — negative regulation of defense response
- GO:0043069 — Biological Process — negative regulation of programmed cell death
- GO:0050832 — Biological Process — defense response to fungus
- GO:0005634 — Cellular Component — nucleus
- GO:0005789 — Cellular Component — endoplasmic reticulum membrane
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
- GO:0043565 — Molecular Function — sequence-specific DNA binding
Family Introduction
- The bZIP domain consists of two structural features located on a contiguous alpha-helix: first, a basic region of ~ 16 amino acid residues containing a nuclear localization signal followed by an invariant N-x7-R/K motif that contacts the DNA; and, second, a heptad repeat of leucines or other bulky hydrophobic amino acids positioned exactly nine amino acids towards the C-terminus, creating an amphipathic helix. To bind DNA, two subunits adhere via interactions between the hydrophobic sides of their helices, which creates a superimposing coiled-coil structure. The ability to form homo- and heterodimers is influenced by the electrostatic attraction and repulsion of polar residues flanking the hydrophobic interaction surface of the helices.
- Plant bZIP proteins preferentially bind to DNA sequences with an ACGT core. Binding specificity is regulated by flanking nucleotides. Plant bZIPs preferentially bind to the A-box (TACGTA), C-box (GACGTC) and G-box (CACGTG), but there are also examples of nonpalindromic binding sites.
Literature and News
Gene Resources
Sequences
CDS Sequence:
- >EMT18702|Aegilops_tauschii|bZIP|EMT18702
ATGGACACCGACCTCGACCTGGACGCCCTCCTCGCCTCCTTCGCCGGCGAGTCCGCCGCAGTCTCCGAGCTCCTCGCCCCGCCTCCGCTTGATGCGGCGGAGGCGGGGGGGCCGGAGGCGGAGGAGGAGGCGGCGGGGGCGGAGCCGGTGGACGGGATCAGCGTGGACGAGTTCTTGGACACGCTGTTCGACGGCGCCGAGGAGGGGGGCGAGAAGGGGAACGGGAGTGAGGCTGAGGCTGGGGGCAGCACCGATGGGGACTCTAGGAGGGGGGAAGACGGGGTGGAGGTGGTGACGCCGGAGACAGAGGCGGAGGTGGTGACGCCCGAGACGGAGGTCGATGGCGATGATCCCATCAGCAAGAAGAAGAGGAGGCAAATGAGGAATAGGGATTCTGCCATGAAGTCCAGGGAGAGGAAGAAGTCATATGTGAAGGACTTGGAGACGAAGAGCAAGTATCTCGAGGCAGAGTGTCGCCGCCTCAGCTACGCACTTCAGTGCTGCGCAGCTGAGAACATGGCACTGCGCCAGAACATGTTGAAGGATAGGCCTATTGGTGCTCACACAGCCATGCAGGAGTCTGCCGTACTTTCGGAACTTAGCGAGCTTGATGTCTCAGAACTTAAGAGTTTGCATGAAATGCAACCTGGATTACTTGCTCGCAGAAACTTAAGCTGTGCTAAATGTAATTGTTTTCATTTTGCAGAACCCCTGCCGCTGGTTTCCCTGCTTTGGCTAGTGAGCATCGTGTGCCTATTCCTAACGCCCGGTCTACCCAACCGAAGTCTGGTGGCTCCAAGGAGAGCCGAAAGAGATCTCGCAATGGTAGCCGGAAAGCCAAGCAGTGATCAACCAGAGACCTTGGAGCTTCTGCTCCATGGAAGGCGCTGGAGGGGCACAAGGGAGAGGATCAAGCTAGATACTCCGCCATTGCGTGCAGCTGCCGCTTGCTAG
Protein Sequence:
- >EMT18702|Aegilops_tauschii|bZIP|EMT18702
MDTDLDLDALLASFAGESAAVSELLAPPPLDAAEAGGPEAEEEAAGAEPVDGISVDEFLDTLFDGAEEGGEKGNGSEAEAGGSTDGDSRRGEDGVEVVTPETEAEVVTPETEVDGDDPISKKKRRQMRNRDSAMKSRERKKSYVKDLETKSKYLEAECRRLSYALQCCAAENMALRQNMLKDRPIGAHTAMQESAVLSELSELDVSELKSLHEMQPGLLARRNLSCAKCNCFHFAEPLPLVSLLWLVSIVCLFLTPGLPNRSLVAPRRAERDLAMVAGKPSSDQPETLELLLHGRRWRGTRERIKLDTPPLRAAAAC