Gene Details:
- Gene ID: cra_locus_12222_iso_6
- Gene Family: bZIP Family
- Description: bZIP Family protein
- Species: Catharanthus roseus
- Source: bZIP family gene from PlantTFDB
Protein Features:
- SMART: SM00338
- Gene3D: G3DSA:1.20.5.170
- PROSITE profile: PS50217
- Pfam: PF00170
- SuperFamily: SSF57959
- PROSITE pattern: PS00036
- InterPro: IPR004827
Annotation Proteins:
- Refseq: XP_010647869.1 — PREDICTED: transcription factor TGA2.3
- Refseq: XP_019076430.1 — PREDICTED: transcription factor TGA2.3
- Swissprot: Q5Z6N9 — TGAL3_ORYSJ; Transcription factor TGAL3
- Swissprot: Q9SX27 — PAN_ARATH; Transcription factor PERIANTHIA
- TrEMBL: D7T978 — D7T978_VITVI; Uncharacterized protein
- STRING: VIT_01s0011g03230.t01 — (Vitis vinifera)
Gene Ontology:
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0009909 — Biological Process — regulation of flower development
- GO:0005634 — Cellular Component — nucleus
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
- GO:0043565 — Molecular Function — sequence-specific DNA binding
Family Introduction:
- The bZIP domain consists of two structural features located on a contiguous alpha-helix: first, a basic region of ~ 16 amino acid residues containing a nuclear localization signal followed by an invariant N-x7-R/K motif that contacts the DNA; and, second, a heptad repeat of leucines or other bulky hydrophobic amino acids positioned exactly nine amino acids towards the C-terminus, creating an amphipathic helix. To bind DNA, two subunits adhere via interactions between the hydrophobic sides of their helices, which creates a superimposing coiled-coil structure. The ability to form homo- and heterodimers is influenced by the electrostatic attraction and repulsion of polar residues flanking the hydrophobic interaction surface of the helices.
- Plant bZIP proteins preferentially bind to DNA sequences with an ACGT core. Binding specificity is regulated by flanking nucleotides. Plant bZIPs preferentially bind to the A-box (TACGTA), C-box (GACGTC) and G-box (CACGTG), but there are also examples of nonpalindromic binding sites.
Literature:
Sequences:
CDS Sequence:
- >cra_locus_12222_iso_6|Catharanthus_roseus|bZIP|cra_locus_12222_iso_6
Protein Sequence:
- >cra_locus_12222_iso_6|Catharanthus_roseus|bZIP|cra_locus_12222_iso_6
MGASVVDSVEQSGGRTGDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRIKLTQLEQELKRARQQGMFIPAGHSGDQSHFTGENGGLAFDLDYARWLDEHQRLINDLRSAVNSHLGDNELRLLVDGVMSHYDEIFRLKSIGTKSDVFHMLSGMWKSPAERCFMWLGGFRSSEILKILGDHLEPLTDQQLIGICNLQQSSQQAEDALSQGMEALQQSLVDTLSSNCLGSAGSGNVADYMGQMAIAMGKLATLENFLHQADLLRQQTLQQMHRILTTRQAARALLVLSDYMSRLRALSSLWLARPKD