Information report for CA06g12310
Gene Details
|
|
Functional Annotation
- Refseq: NP_001311949.1 — transcription factor VIP1-like
- Swissprot: Q9MA75 — VIP1_ARATH; Transcription factor VIP1
- TrEMBL: A0A1U8GVH4 — A0A1U8GVH4_CAPAN; Transcription factor VIP1
- TrEMBL: A0A2G2ZAE4 — A0A2G2ZAE4_CAPAN; transcription factor VIP1-like
- STRING: PGSC0003DMT400045314 — (Solanum tuberosum)
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0007231 — Biological Process — osmosensory signaling pathway
- GO:0008272 — Biological Process — sulfate transport
- GO:0009294 — Biological Process — DNA mediated transformation
- GO:0009652 — Biological Process — thigmotropism
- GO:0009970 — Biological Process — cellular response to sulfate starvation
- GO:0045596 — Biological Process — negative regulation of cell differentiation
- GO:0051170 — Biological Process — nuclear import
- GO:0005634 — Cellular Component — nucleus
- GO:0005829 — Cellular Component — cytosol
- GO:0003682 — Molecular Function — chromatin binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
- GO:0043565 — Molecular Function — sequence-specific DNA binding
- GO:0043621 — Molecular Function — protein self-association
- GO:0051019 — Molecular Function — mitogen-activated protein kinase binding
Family Introduction
- The bZIP domain consists of two structural features located on a contiguous alpha-helix: first, a basic region of ~ 16 amino acid residues containing a nuclear localization signal followed by an invariant N-x7-R/K motif that contacts the DNA; and, second, a heptad repeat of leucines or other bulky hydrophobic amino acids positioned exactly nine amino acids towards the C-terminus, creating an amphipathic helix. To bind DNA, two subunits adhere via interactions between the hydrophobic sides of their helices, which creates a superimposing coiled-coil structure. The ability to form homo- and heterodimers is influenced by the electrostatic attraction and repulsion of polar residues flanking the hydrophobic interaction surface of the helices.
- Plant bZIP proteins preferentially bind to DNA sequences with an ACGT core. Binding specificity is regulated by flanking nucleotides. Plant bZIPs preferentially bind to the A-box (TACGTA), C-box (GACGTC) and G-box (CACGTG), but there are also examples of nonpalindromic binding sites.
Literature and News
Gene Resources
Homologs
- Nicotiana benthamiana: Niben101Scf18667g02004.1, Niben101Scf01180g02009.1, Niben101Scf01150g00005.1, Niben101Scf02191g00014.1
- Nicotiana tabacum: XP_016478843.1, XP_016497240.1, XP_016458867.1
- Petunia inflata: Peinf101Scf04304g00023.1, Peinf101Scf02872g01031.1, Peinf101Scf00600g07016.1
- Solanum lycopersicum: Solyc06g060490.2.1, Solyc04g071160.2.1
- Solanum melongena: Sme2.5_05675.1_g00001.1, Sme2.5_00678.1_g00005.1
- Solanum tuberosum: PGSC0003DMP400030704, PGSC0003DMP400001527, PGSC0003DMP400050715
Sequences
CDS Sequence:
- >CA06g12310|Capsicum_annuum|bZIP|CA06g12310
ATGGACCCTAAGTTCGCCGGAAAGCCCATTCAGGCCCAATTCTATTCGGGTCAAACTGACCTGGACCAGATGCAAGACACTCCAACACGAGCCCGGCACCGCCGTGCCCAATCGGAAACCTTCTTCCGTTTCCCCAGCTTCGACGATGACATGCTTTTAGACGATGTCGTTTCCGACTTCAGCCTCGATGCTGTTCGAGCTCCTACACTCATGCAACCTGCGAATTCACCCGATTCTTCCTCCACTGGACCGGGTGATAACCCTAATAAACCGCTATCTCATTATCGGAGTTTATCTGTTGATGCTGATTTTTTTGACGGACTGGATTTTGGTCCTGCCTCAATTGAGAAGAAGATGGTGATGGGTTCTGGACCGCGTCATGGACATAGCAATTCCATGGATGGGTCTTTTGATACGACGTCGTTTGAGTCTGAATCGGTTTTGGTTAAGAAGGCTATGGCTCCTGATAAGCTTGCTGAGCTGTCATTGATTGATCCTAAAAGAGCCAAAAGGATTCTAGCAAACAGGCAATCTGCTGCACGTTCTAAGGAGCGAAAAAATCGTTATACTAGTGAGCTAGAAAGGAAAGTGCAGACTCTGCAGACTGAAGCCACCACTCTATCTGCTCAGATCACGGTTCTACAGAGAGACACTTTTGGATTAAATGCTGAAAACAAAGAACTGAAGCTTCGGTTGCAAGCTTTGGAACAACAGGCACATCTTAGAGATGCTCTAAATGAAACGTTGAGGGAAGAACTGCAGCGCCTTAAGATTGAAGCAGGTCAAATCCCAGCTGCAAATGGAAATAGAGGAACGCGTCCTCATTTACCTCCCCATCCACAGTCCTTTGCTCAATGTGGTAATCACCATGCACAACAGCAGCAGATTCCGCGTCCGACCACAAGTAACCAAACTGTCCCTGGGCAATCTCCAAATAGCTTCTTCAACTTCAACAGGGCTTGA
Protein Sequence:
- >CA06g12310|Capsicum_annuum|bZIP|CA06g12310
MDPKFAGKPIQAQFYSGQTDLDQMQDTPTRARHRRAQSETFFRFPSFDDDMLLDDVVSDFSLDAVRAPTLMQPANSPDSSSTGPGDNPNKPLSHYRSLSVDADFFDGLDFGPASIEKKMVMGSGPRHGHSNSMDGSFDTTSFESESVLVKKAMAPDKLAELSLIDPKRAKRILANRQSAARSKERKNRYTSELERKVQTLQTEATTLSAQITVLQRDTFGLNAENKELKLRLQALEQQAHLRDALNETLREELQRLKIEAGQIPAANGNRGTRPHLPPHPQSFAQCGNHHAQQQQIPRPTTSNQTVPGQSPNSFFNFNRA*