Gene Details:

  • Gene ID: AT1G42990.1
  • Gene Name: ATBZIP60, BZIP60, F13A11.5
  • Gene Family: bZIP Family
  • Description: bZIP Family protein
  • Species: Arabidopsis thaliana
  • Source: bZIP family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  NP_174998.1  — basic region/leucine zipper motif 60
  • Swissprot:  Q9C7S0  — BZP60_ARATH; bZIP transcription factor 60
  • TrEMBL:  A0A178WJM4  — A0A178WJM4_ARATH; BZIP60
  • STRING:  AT1G42990.1  — (Arabidopsis thaliana)

Gene Ontology:

  • GO:0002376  — Biological Process — immune system process
  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:0010200  — Biological Process — response to chitin
  • GO:0030968  — Biological Process — endoplasmic reticulum unfolded protein response
  • GO:0005634  — Cellular Component — nucleus
  • GO:0005789  — Cellular Component — endoplasmic reticulum membrane
  • GO:0016021  — Cellular Component — integral component of membrane
  • GO:0003700  — Molecular Function — transcription factor activity, sequence-specific DNA binding
  • GO:0043565  — Molecular Function — sequence-specific DNA binding

Family Introduction:

  • The bZIP domain consists of two structural features located on a contiguous alpha-helix: first, a basic region of ~ 16 amino acid residues containing a nuclear localization signal followed by an invariant N-x7-R/K motif that contacts the DNA; and, second, a heptad repeat of leucines or other bulky hydrophobic amino acids positioned exactly nine amino acids towards the C-terminus, creating an amphipathic helix. To bind DNA, two subunits adhere via interactions between the hydrophobic sides of their helices, which creates a superimposing coiled-coil structure. The ability to form homo- and heterodimers is influenced by the electrostatic attraction and repulsion of polar residues flanking the hydrophobic interaction surface of the helices.
  • Plant bZIP proteins preferentially bind to DNA sequences with an ACGT core. Binding specificity is regulated by flanking nucleotides. Plant bZIPs preferentially bind to the A-box (TACGTA), C-box (GACGTC) and G-box (CACGTG), but there are also examples of nonpalindromic binding sites.

Literature:

Sequences:

CDS Sequence:
  • >AT1G42990.1|Arabidopsis_thaliana|bZIP|AT1G42990.1
    ATGGCGGAGGAATTTGGAAGCATAGATTTACTCGGAGATGAAGATTTCTTCTTCGATTTCGATCCTTCAATCGTAATTGATTCTCTTCCGGCGGAGGATTTTCTTCAGTCTTCACCGGATTCATGGATCGGAGAAATCGAGAATCAATTGATGAACGATGAGAATCATCAAGAGGAGAGTTTTGTGGAATTGGATCAGCAATCGGTTTCAGATTTCATAGCGGATCTACTCGTTGATTATCCAACTAGCGATTCTGGCTCCGTTGATTTGGCGGCTGATAAAGTTCTAACCGTCGATTCTCCCGCCGCCGCTGATGATTCCGGGAAGGAGAATTCGGATTTGGTTGTTGAGAAGAAGTCTAATGATTCTGGTAGCGAGATTCATGATGATGATGACGAAGAAGGAGACGATGATGCTGTGGCTAAAAAACGAAGAAGGAGAGTAAGAAATAGAGATGCGGCGGTTAGATCGAGAGAGAGGAAGAAGGAATATGTACAAGATTTAGAGAAGAAGAGTAAGTATCTCGAAAGAGAATGCTTGAGACTAGGACGTATGCTTGAGTGCTTCGTTGCTGAAAACCAGTCTCTACGTTACTGTTTGCAAAAGGGTAATGGCAATAATACTACCATGATGTCGAAGCAGGAGTCTGCTGTGCTCTTGTTGGAATCCCTGCTGTTGGGTTCCCTGCTTTGGCTTCTGGGAGTAAACTTCATTTGCCTATTCCCTTATATGTCCCACACAAAGTGTTGCCTCCTACGTCCAGAACCAGAAAAGCTGGTTCTAAACGGGCTCGGGAGTAGTAGCAAACCGTCTTATACCGGCGTTAGTCGGAGATGTAAGGGTTCGAGGCCTAGGATGAAATACCAAATCTTAACCCTTGCGGCGTGA
Protein Sequence:
  • >AT1G42990.1|Arabidopsis_thaliana|bZIP|AT1G42990.1
    MAEEFGSIDLLGDEDFFFDFDPSIVIDSLPAEDFLQSSPDSWIGEIENQLMNDENHQEESFVELDQQSVSDFIADLLVDYPTSDSGSVDLAADKVLTVDSPAAADDSGKENSDLVVEKKSNDSGSEIHDDDDEEGDDDAVAKKRRRRVRNRDAAVRSRERKKEYVQDLEKKSKYLERECLRLGRMLECFVAENQSLRYCLQKGNGNNTTMMSKQESAVLLLESLLLGSLLWLLGVNFICLFPYMSHTKCCLLRPEPEKLVLNGLGSSSKPSYTGVSRRCKGSRPRMKYQILTLAA