Gene Details:

  • Gene ID: Araha.7279s0004.1.p
  • Gene Family: bZIP Family
  • Description: bZIP Family protein
  • Species: Arabidopsis halleri
  • Source: bZIP family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  NP_001320130.1  — abscisic acid responsive elements-binding factor 3
  • Refseq:  NP_567949.1  — abscisic acid responsive elements-binding factor 3
  • Refseq:  NP_849490.2  — abscisic acid responsive elements-binding factor 3
  • Swissprot:  Q9M7Q3  — AI5L6_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 6
  • TrEMBL:  D7MFS7  — D7MFS7_ARALL; Uncharacterized protein
  • STRING:  AT4G34000.1  — (Arabidopsis thaliana)

Gene Ontology:

  • GO:0009414  — Biological Process — response to water deprivation
  • GO:0009651  — Biological Process — response to salt stress
  • GO:0009738  — Biological Process — abscisic acid-activated signaling pathway
  • GO:0045893  — Biological Process — positive regulation of transcription, DNA-templated
  • GO:0000976  — Molecular Function — transcription regulatory region sequence-specific DNA binding
  • GO:0003700  — Molecular Function — transcription factor activity, sequence-specific DNA binding

Family Introduction:

  • The bZIP domain consists of two structural features located on a contiguous alpha-helix: first, a basic region of ~ 16 amino acid residues containing a nuclear localization signal followed by an invariant N-x7-R/K motif that contacts the DNA; and, second, a heptad repeat of leucines or other bulky hydrophobic amino acids positioned exactly nine amino acids towards the C-terminus, creating an amphipathic helix. To bind DNA, two subunits adhere via interactions between the hydrophobic sides of their helices, which creates a superimposing coiled-coil structure. The ability to form homo- and heterodimers is influenced by the electrostatic attraction and repulsion of polar residues flanking the hydrophobic interaction surface of the helices.
  • Plant bZIP proteins preferentially bind to DNA sequences with an ACGT core. Binding specificity is regulated by flanking nucleotides. Plant bZIPs preferentially bind to the A-box (TACGTA), C-box (GACGTC) and G-box (CACGTG), but there are also examples of nonpalindromic binding sites.

Literature:

Sequences:

CDS Sequence:
  • >Araha.7279s0004.1.p|Arabidopsis_halleri|bZIP|Araha.7279s0004.1.p
    CAACAGCTGATACAGAAGCAGGAGAGACCTTTTCCCAAACAGACCACTATCGCGTTTTCCAACACTGCTGATGTAGTTAACCGTTCTCAACCTGCAACACAGTGCCAGGAAGTGAAGCCTTCAATACTTGGAATTCGTAACCATCCTGTGAACAACAATCTACTGCAAGCTGTCGATTTTAAAACAGGGGTAACGGTTGCAGCAGTATCTCCTGGAAGCCAGATGTCACCTGATCTGACTCCAAAGAGCGCCCTGGATGCATCTTTGTCTCCTGTTCCTTACATGTTTGGGCGAGTGAGAAAAACAGGTGCAGTTCTGGAGAAAGTGATTGAGAGAAGGCAAAAAAGGATGATAAAGAATAGGGAATCAGCTGCAAGATCCCGCGCTCGCAAGCAAGCTTATACGATGGAACTGGAAGCAGAAATTGCGCAACTCAAAGAGTTAAATGAAGAGTTGCAGAGGAAACAAGTTGAAATCATGGAAAAGCAGAAAAACCAGCTCCTGGAGCCACTGCGCCAGCCATGGGGAATGGGATGCAAAAGGCAATGCTTGCGAAGGACATTAACGGGTCCCTGGTAG
Protein Sequence:
  • >Araha.7279s0004.1.p|Arabidopsis_halleri|bZIP|Araha.7279s0004.1.p
    QQLIQKQERPFPKQTTIAFSNTADVVNRSQPATQCQEVKPSILGIRNHPVNNNLLQAVDFKTGVTVAAVSPGSQMSPDLTPKSALDASLSPVPYMFGRVRKTGAVLEKVIERRQKRMIKNRESAARSRARKQAYTMELEAEIAQLKELNEELQRKQVEIMEKQKNQLLEPLRQPWGMGCKRQCLRRTLTGPW*