Gene Details:

  • Gene ID: AA31G00416
  • Gene Family: bZIP Family
  • Description: bZIP Family protein
  • Species: Aethionema arabicum
  • Source: bZIP family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_002887591.1  — bZIP transcription factor 44
  • Swissprot:  C0Z2L5  — BZP44_ARATH; bZIP transcription factor 44
  • TrEMBL:  D7KSN7  — D7KSN7_ARALL; BZIP transcription factor family protein
  • STRING:  scaffold_202483.1  — (Arabidopsis lyrata)

Gene Ontology:

  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:0009845  — Biological Process — seed germination
  • GO:0003700  — Molecular Function — transcription factor activity, sequence-specific DNA binding
  • GO:0043565  — Molecular Function — sequence-specific DNA binding
  • GO:0044212  — Molecular Function — transcription regulatory region DNA binding
  • GO:0046982  — Molecular Function — protein heterodimerization activity

Family Introduction:

  • The bZIP domain consists of two structural features located on a contiguous alpha-helix: first, a basic region of ~ 16 amino acid residues containing a nuclear localization signal followed by an invariant N-x7-R/K motif that contacts the DNA; and, second, a heptad repeat of leucines or other bulky hydrophobic amino acids positioned exactly nine amino acids towards the C-terminus, creating an amphipathic helix. To bind DNA, two subunits adhere via interactions between the hydrophobic sides of their helices, which creates a superimposing coiled-coil structure. The ability to form homo- and heterodimers is influenced by the electrostatic attraction and repulsion of polar residues flanking the hydrophobic interaction surface of the helices.
  • Plant bZIP proteins preferentially bind to DNA sequences with an ACGT core. Binding specificity is regulated by flanking nucleotides. Plant bZIPs preferentially bind to the A-box (TACGTA), C-box (GACGTC) and G-box (CACGTG), but there are also examples of nonpalindromic binding sites.

Literature:

Sequences:

CDS Sequence:
  • >AA31G00416|Aethionema_arabicum|bZIP|AA31G00416
    ATGGGATCTTCGACGAGTGGAAATTGCTCGTCGATTTCAACAACGACGGGATCGGAATCGGATCTCCGGCAGAAGGATCTTATTGATGAACGGAAGAGGAAACGGAAGCAATCGAATAGAGATTCAGCGAGGCGATCGAGGTTGAGGAAGCAGAAACACTTAGACGATCTAACGGCTCAGGTTTCTCAGCTACGGAAGGAGAACGGTGAGATCGTCGCTGGAATCGCACTCACTACACAACACTACATGGCAATCGAAGCTGAAAACTCCATTCTCAGAGCTCAAGCTCTGGAACTCAACCGCCGCCTCCAATCTCTCAACGAAATCGTCGATTTCGTTGAATCCTCTTCTTCCCTCGCCGCTGGGTGCTGTCGCGGCAGAGATTTCGCCTCTGGTTCTAGCATCGGAGGATTCGGCGTGGAGCTGAGTGGTGTTGGAGTATACGACGGCGTCGGAGGTGGATTTTACGACGGAGGAATCATGAATCCGCTCAATTTAGGGTTTTATAATCAACCAATCATGGCTGCTGCTGCAACTGCTGGTGATATCTTCCAGTGC
Protein Sequence:
  • >AA31G00416|Aethionema_arabicum|bZIP|AA31G00416
    MGSSTSGNCSSISTTTGSESDLRQKDLIDERKRKRKQSNRDSARRSRLRKQKHLDDLTAQVSQLRKENGEIVAGIALTTQHYMAIEAENSILRAQALELNRRLQSLNEIVDFVESSSSLAAGCCRGRDFASGSSIGGFGVELSGVGVYDGVGGGFYDGGIMNPLNLGFYNQPIMAAAATAGDIFQC