Information report for 99404
Gene Details
Functional Annotation
- Refseq: XP_002973198.1 — transcription factor HY5 isoform X1
- Refseq: XP_024533940.1 — transcription factor HY5 isoform X2
- Refseq: XP_024537316.1 — transcription factor HY5 isoform X1
- Refseq: XP_024537317.1 — transcription factor HY5 isoform X2
- Swissprot: Q9SM50 — HY5_SOLLC; Transcription factor HY5
- TrEMBL: D8RQ04 — D8RQ04_SELML; Uncharacterized protein HY5B-1
- STRING: EFJ22323 — (Selaginella moellendorffii)
- STRING: EFJ25572 — (Selaginella moellendorffii)
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0009737 — Biological Process — response to abscisic acid
- GO:0009740 — Biological Process — gibberellic acid mediated signaling pathway
- GO:0010017 — Biological Process — red or far-red light signaling pathway
- GO:0010099 — Biological Process — regulation of photomorphogenesis
- GO:0010114 — Biological Process — response to red light
- GO:0010218 — Biological Process — response to far red light
- GO:0010224 — Biological Process — response to UV-B
- GO:0031539 — Biological Process — positive regulation of anthocyanin metabolic process
- GO:0042753 — Biological Process — positive regulation of circadian rhythm
- GO:0080167 — Biological Process — response to karrikin
- GO:0005634 — Cellular Component — nucleus
- GO:0003690 — Molecular Function — double-stranded DNA binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
- GO:0043565 — Molecular Function — sequence-specific DNA binding
Family Introduction
- The bZIP domain consists of two structural features located on a contiguous alpha-helix: first, a basic region of ~ 16 amino acid residues containing a nuclear localization signal followed by an invariant N-x7-R/K motif that contacts the DNA; and, second, a heptad repeat of leucines or other bulky hydrophobic amino acids positioned exactly nine amino acids towards the C-terminus, creating an amphipathic helix. To bind DNA, two subunits adhere via interactions between the hydrophobic sides of their helices, which creates a superimposing coiled-coil structure. The ability to form homo- and heterodimers is influenced by the electrostatic attraction and repulsion of polar residues flanking the hydrophobic interaction surface of the helices.
- Plant bZIP proteins preferentially bind to DNA sequences with an ACGT core. Binding specificity is regulated by flanking nucleotides. Plant bZIPs preferentially bind to the A-box (TACGTA), C-box (GACGTC) and G-box (CACGTG), but there are also examples of nonpalindromic binding sites.
Literature and News
Gene Resources
Homologs
- Capsicum annuum: CA03g10440
- Musa acuminata: GSMUA_Achr7P09980_001, GSMUA_Achr10P27050_001, GSMUA_Achr5P06060_001
- Populus trichocarpa: Potri.018G029500.3, Potri.018G029500.2, Potri.018G029500.1
- Zea mays: GRMZM2G171912_P02, GRMZM2G171912_P01
Sequences
CDS Sequence:
- >99404|Selaginella_moellendorffii|bZIP|99404
ATGGGTTTTGATCACGATCACGTTTGCAACACAGGCCTCGTTCTAAGGTTAGGTTTCTCACCGACGACCGCGACCGCGACCGCGACAGCGGCTAAGAAGCCGAGTACGACTACTAACAGTAGTAGTACTCCTTTTGAGCCTTCTTTATTAACTTTGGGCCTCTCCGGCGGTGGAGATGAGGCTCATGACAACAACAACAACAACAACAACAGCAGCAGCAACAATAACAACAACAGAAAGATTATTGATGTGAGCAAAAGTTTCCACGATCATCATCTTCATCAGGAACCAGTACAAAACAACAATAATAGTAACAATAACATTAGTGTTCACGACAACAGCTTGTACCGCCAAGCGTCGCCTCACAGCGCGGTCTCGTCCTTCTCCGGCGGAAGGGTCAAGAGAGAGAGAGATCTCAGCAGTGAAGAGATTGAGGTTGAGGAGAAAGTTTCCTTATCTAGAGTTAGTGATGAAGATGAAGATGGTACTAATGCCAGAAAGAAGCTTAGGCTTACCAAAGACCAATCTGCCCTCTTGGAGGAAAGCTTCAAACAACACAGCACTCTCAATCCTAAACAAAAGCAAGCTTTAGCCAGACAGTTGAATCTTCGGCCAAGACAAGTTGAAGTATGGTTCCAGAATAGGCGAGCTAGGACAAAGCTGAAGCAAACAGAAGTGGATTGCGAGTTCTTGAAGAAGTGCTGCGAGACATTAACGGATGAGAACAGAAGGCTACACAAAGAGCTACAAGAGCTCAAGGCTTTGAAACTAGCGCAACCCTTGTACATGCACATGCCGGCGGCGACGCTCACCATGTGTCCGTCGTGCGAAAGGATCGTCGGCGGCGTCGGCGGCGATGTCGTTGGCGGTTCGGCCAAGAGCCCGTTTTCCATGGCTCCTAAGCCACACTTCTATAATCCCTTCACCAATCCTTCTGCTGCTTGTTGA CGCAAGAGGGGTGCTGTTCCTGCTGACAAAGAACACAAGCGATTGAAAAGACTTTTACGCAATCGAGTCTCGGCACAACAAGCCAGGGAGAGAAAAAAGGCTTACGTTGTTGAGCTCGAAGCAAAAGCCCGGGATTTGGAGCTCAGGAATGCGGAGCTAGAGGAACGGGTAAACACGTTACAAAAGGAAACATTCATGCTGCGACAGGTGAAAAAAGCGAAAGTTTTTTTTTTCCTACATTGA
Protein Sequence:
- >99404|Selaginella_moellendorffii|bZIP|99404
RKRGAVPADKEHKRLKRLLRNRVSAQQARERKKAYVVELEAKARDLELRNAELEERVNTLQKETFMLRQVKKAKVFFFLH*